KEGG   Edwardsiella ictaluri: NT01EI_0563Help
Entry
NT01EI_0563       CDS       T00912                                 

Definition
thymidine phosphorylase, putative (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eic  Edwardsiella ictaluri
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NT01EI_0563
Enzymes [BR:eic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NT01EI_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556169..557491
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGRALSEEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVALT
MAMRDSGTVLDWNSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGFDIFPDDSRFRSIIADIGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFELSEALAQAIVGVANGAGCRTTALLT
DMNQVLASSAGNALEVREAVQFLTGKARNPRLFEVTMALCVEMLISGKLAADQTEARSKL
QAVLDNGRAAEIFGRMVAAQGGPRDFVERYDHYLPQAVLCKPVFAEQAGIITAMDTRALG
MSVVGLGGGRRQASDSIDYSVGLTDMVRLGDSVDGQRPLAVVHARDEASWQQAAEAVRAA
VTLGGCVPEPTPVVYRRITQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggctcaagaaattatccgcaaaaagcgcgacggccgtgcgctgagcgaagaa
gagattcgctttttcatcaatgggatccgggataacacgatctccgaggggcagatcgcc
gcgctggcgatgacgatctttttccacgacatgtccatgccggagcgcgtggcgctgacc
atggcgatgcgggactccggtactgtgctggactggaactccctgaatctgaacgggccg
attgttgataaacattcgaccggcggcgtgggagacgttacctctctgatgctggggccg
atggtcgccgcctgcggtggctatgtgccgatgatttccggtcgcggcctcgggcatacc
ggtggcacgctggataagttagaatcgatccctggattcgatattttcccggatgacagc
cgttttcgcagcattattgccgatatcggcgtcgccattatcggacagaccagctcgctg
gcgccggcggataagcgtttttacgcgacgcgcgatatcactgcgacggtagactctatt
cctctgatcaccgcctccattctggccaagaagctggccgaagggctggatgcgctggtg
atggatgtgaaggttggctctggcgcctttatgccgacgttcgagctgtctgaggcgctg
gcgcaggcgatcgttggtgtagccaacggcgcaggctgtcgaaccacggcgctgctgacc
gacatgaatcaggtactggcctccagcgccggtaatgcactggaagtgcgcgaggcagta
cagttcctgacgggcaaggcgcgcaatccacgtctgttcgaggtgaccatggcgctgtgc
gtcgagatgctgatttccggtaaactggccgcagatcagacggaggcccgcagtaaactg
caggcggtgctcgacaacggtagagctgcagagatctttggccggatggtggcggcgcag
ggcggtccgcgagacttcgttgagcgctatgaccactatttgccacaggcagtgctgtgt
aaaccggtatttgccgaacaagctggtattatcacagcaatggacacccgggcgctgggg
atgtccgttgtcgggttgggcggtggtcgccgtcaggccagcgatagcattgattacagc
gtagggctaaccgatatggttcgtctgggtgattcggtcgatggacaacgcccgctggct
gtggttcatgcccgtgatgaagcgagctggcagcaggccgccgaggcggtgcgtgccgcg
gtgacgctgggtgggtgtgtacctgagccgacgccggtggtgtatcgccgtatcactcag
taa

DBGET integrated database retrieval system