KEGG   Edwardsiella ictaluri: NT01EI_0661Help
Entry
NT01EI_0661       CDS       T00912                                 

Definition
(RefSeq) threonine synthase, putative (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01EI_0661
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01EI_0661
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NT01EI_0661
Enzymes [BR:eic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NT01EI_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646657..647943
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHELPALARTQVDSLLEQDFVTRSAHILA
AYLGDEFPFDTLWARVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPMLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWALGALGYGALSDAQTAEAMRELAALGYVSEPHAAIAYRA
LCDSLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALEARAELPLLSQTLPADFSRL
RAALLERP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaacttaaaagatcacaacgagcaggttaactttgcgcaggcactggtg
caggggttggggcgccagcagggactgttctttccccatgagctgcccgccctggcacgg
acgcaggtcgattccctgctggagcaggattttgtgacccgcagcgcgcatattctggcg
gcgtacctgggagatgagttcccctttgatacgttgtgggcgcgggttcaggccgctttt
gattttcctgcgccggtggtgccggtcagcgacgatatcgctgcgctggagctgttccac
gggccgacgctggccttcaaggacttcggtgggcgctttatggcgcagatgctgcagcag
gtcgcgggggagcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggt
aaggtcagtccgctgcaggagaagctgttctgtaccttgggcggcaatattcgtacgctg
gcgatcgagggcgacttcgatgcctgccaggcgctggtcaagcaggcgtttgacgatccg
atgctgtgccgagaactggggttgaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtgccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgccaccaatgccaatgataccgttccg
cgctttttatccagcggcgtctggcagcctcatgagaccgtcgcgaccctctccaatgcc
atggatgtcagccgtcccaacaactggccgcgggtggaggagctgttccggcgtagggag
tgggcactgggcgcgctgggctacggggcgctgagcgatgcgcagacggcggaggcgatg
cgtgagctggcggcgctcggctatgttagcgaaccccatgccgctatcgcctaccgggcg
ctgtgcgacagcctgcaacccggcgagtatggcctgtttctgggaacagcccatccggcc
aagttccaagagtctgtcgaggcgatcctgcagcggagcatcccgctaccgcaagcgttg
gaggcgcgggctgaactgccgctgttgtcacagacgctgcccgctgatttttcccgcctg
cgggcggcgctgctggaacgcccatga

DBGET integrated database retrieval system