KEGG   Edwardsiella ictaluri: NT01EI_0693Help
Entry
NT01EI_0693       CDS       T00912                                 

Definition
dihydrofolate reductase, putative (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eic  Edwardsiella ictaluri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT01EI_0693
   00670 One carbon pool by folate
    NT01EI_0693
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NT01EI_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681486..681968
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALSADRVIGLDNAMPWHLSADLAWFKRNTLAKPVIMGRKTYESIGRPLPGRHN
IVISRQAGCDDRVSWVATPEAALTAAADADEVMIIGGGTLYEQFLPQASRLYLTHVDADV
AGDTYFPDYAPDEWQTCFSEFHEADSDNSHAYCFEILDRR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcactcagcgcggatcgtgtgatcggtttagacaatgct
atgccatggcatttgtcggccgatcttgcgtggtttaagcgcaatactctggcaaaacca
gtgatcatggggcgtaaaacctatgagtccatcgggcgcccgctgccgggtcgtcataat
atcgtgatcagccgccaggcgggctgtgacgatcgtgtgagttgggtagcgacacccgag
gctgcactgactgccgctgcagatgctgatgaggtgatgattatcggcggcggtacgctg
tatgagcagtttttaccgcaggcgagccgactgtatctgacccacgtggacgctgacgtc
gccggagacacctatttccccgactatgcaccggatgagtggcagacgtgcttcagtgag
tttcatgaggccgatagcgacaattcacacgcctactgctttgagatcctggatcgccgt
taa

DBGET integrated database retrieval system