KEGG   Edwardsiella ictaluri: NT01EI_0731Help
Entry
NT01EI_0731       CDS       T00912                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase; putative (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eic  Edwardsiella ictaluri
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NT01EI_0731
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT01EI_0731
Enzymes [BR:eic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NT01EI_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728009..729496
Genome map
AA seq 495 aa AA seqDB search
MADRNLRALLAPWVTQAPERALRDMTLDSRVAAAGDLFVAVVGHAADGRRFIPQAIAQGV
AAVIAEAEGEAEDGSVRELHGVPVVYLNRLNERLSALAGRFYGQPGADLRLVGVTGTNGK
TTTTQLLAQWAQLLGETGAVMGTVGNGLLGHVYPSENTTGSAVDVQHMLRTLADDGATLV
AMEVSSHGLVQNRVLALPFAASAFTNLSRDHLDYHGDMEHYAQAKWRLFSTHHSGEKIVN
ADDEMGLLWLDKLPDAVAVTVTGVLPEGWAGRWLAACSVAYHDGGATIAFDSSWGEGTLN
SRLMGEFNVSNLLVALATLLALGYPLAALCAASVQLQPVCGRMEVFQAPAKPTVVVDYAH
TPDALEKALLAARLHCQGQLWCLFGCGGDRDTGKRPLMGAIAEQYADRVVVTDDNPRSEE
PRAIINEILSGMLDPGLAMAIPGRAEAVTAAVMQAAPQDVILVAGKGHEDYQLVGNRRLD
YSDRVTVARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgcgcttttggctccttgggttacacaggccccggagcgc
gctttgcgggacatgactttggacagccgcgtggcggctgcaggcgatctgtttgtggcc
gttgtcggccatgcggcggatggacgccgttttattccgcaggccattgcgcagggcgtt
gccgccgttatcgctgaggctgagggcgaggccgaagatggcagcgtacgcgagctgcac
ggcgttccggtagtgtatctcaaccgtctcaacgagcgtctttctgcgctggcagggcgt
ttctacggtcaaccgggtgccgatctgcgtctggtgggtgtgaccggcactaacggtaaa
acgacgaccacccagctgttggcacagtgggcgcagctgttgggtgaaaccggcgccgtg
atggggactgtcggcaatggcctgctggggcatgtttatcccagtgagaacaccacagga
tcagctgtcgacgtacagcacatgctgcgcacgctggccgatgacggcgcaacgctggta
gcgatggaggtctcctcccatggtctggtgcaaaaccgggtgctggcgctgccgtttgcc
gcgtcggcctttaccaacctgagccgcgatcacctggattaccacggtgatatggagcac
tacgcacaggcgaagtggcgcctgttctcgacccatcacagcggtgagaagatcgtcaat
gctgatgatgagatggggctcctctggctggataagctaccggatgcggtggcggtgact
gtcaccggtgtactgcccgaaggttgggcgggccgctggctggccgcgtgctcggtggcg
tatcacgacggcggcgcgacgattgcgttcgactccagctggggagagggtacgctgaac
agtcgcctgatgggcgagtttaacgtgagtaatctgctggttgcgctggcgacactgctg
gcgctcggctatccgctggcggcgctgtgcgctgcgtctgtccagctgcagccggtctgt
gggcgaatggaggtgtttcaggcgcccgctaagcctacggtggttgtcgactatgcccat
acgccggatgcgttggaaaaagcgctgctggctgcgcgtttgcattgccaggggcagctg
tggtgcctatttggctgcggcggggatcgcgatacgggcaaacgtccgctgatgggggcg
attgccgaacagtatgccgaccgggtagtggtgacagacgataacccgcgcagtgaagag
ccgcgggcgatcatcaatgaaattctcagcggtatgctggatccggggttggcgatggcc
atccccgggcgtgcagaggcggtgaccgccgccgtgatgcaggcggccccgcaggatgtg
atcttggtggccggtaaggggcatgaggattatcagctggtcggcaaccgccgtctggac
tattccgatcgggtgacggtagcccgtctgctgggggtggtagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system