KEGG   Edwardsiella ictaluri: NT01EI_0759Help
Entry
NT01EI_0759       CDS       T00912                                 

Definition
dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex, putative (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_0759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_0759
   00020 Citrate cycle (TCA cycle)
    NT01EI_0759
   00620 Pyruvate metabolism
    NT01EI_0759
Enzymes [BR:eic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NT01EI_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760100..761668
Genome map
AA seq 522 aa AA seqDB search
MAIAIKVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGIIRAIKVV
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAPAAAAQVRDVQVPDIGGDEVEVTEILV
KVGDSVSAEQSLITVEGDKASMEVPAPFSGVVQSITIATGDKVKTGSPIMTFSVAGSASV
PSASAPAAALPVSAPTASPVAAPAVVQAESEFTENTAYVHATPVIRRLAREFGVNLARVK
GSGRKGRILREDVQAYVKELIKRAETAPVAAGGALPGLLPWPKVDFSKFGEVEEVELDRI
QKISGANLHRNWVMIPHVTQFDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAVA
KALEAMPRFNSSLSEDAQRLTLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAE
ISAKARAGKLTATDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKE
FAPRLMLPLALSYDHRVIDGADGARFISFINSVMSDIRRLVM
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaaggtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtcgctgatcaccgttgagggcgac
aaggcttcaatggaggttccctcgccgcaggccggcattatccgcgccatcaaggttgtg
gtgggcgataaggtcacaaccggttctctgatcatggagtttgaggcggcagatgccgcc
gcagcccaaccggcggctcaggtgcagccggcagcggctccggccgccgctgcgcaggtg
cgtgatgttcaggtgccggatatcggtggcgatgaggttgaggtcaccgaaattctggtt
aaggtgggcgacagcgtcagcgctgagcagtcgctgatcaccgtcgaaggcgataaggcc
tcgatggaggttccggcgccgttctccggggtggttcaatccatcactatcgccaccggc
gacaaggtgaagaccggttcgccgatcatgaccttcagcgtggcgggcagcgcgtcagtg
ccgtcggcatctgcgccagcggctgcgctaccggtaagtgcaccgacagcctcaccggtt
gccgcgcctgcggtggtacaggcggagagcgaatttaccgaaaacaccgcctatgtgcat
gcgacgccggtgatccgccgtctggcgcgcgagtttggtgttaacctggccagggtaaaa
ggcagtgggcgtaaaggccgtattctgcgtgaagacgtacaggcttatgtcaaagagctg
attaagcgtgctgaaactgcaccggtggctgccggaggggccctgccgggtctgctgccg
tggccgaaagtggacttcagcaagttcggcgaggtggaagaggttgagctggatcgtatc
cagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtcacccag
tttgacgagaccgatattaccgaggtggaagcgttccgcaaacagcagaacgtggagtcc
gagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcggtggct
aaggcgctggaggcgatgccgcgctttaacagctccctgtctgaggatgcccagcgtctg
acgctgaagaagtacatcaatatcggtgttgcggtcgatacgccgaacggcctggtggtt
ccggtgctgcgcgacgtcaataagaagggcatcatcgagctgtcgcgcgatctggcggaa
atctcagccaaggcgcgtgccggcaagctgaccgccacggacatgcagggcggctgcttt
accatctctagcttgggtggtatcggcggcacggcgtttacgccgatcgtcaacgcaccg
gaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatgggaaagag
tttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggttatcgacggt
gccgacggcgcccgctttatcagtttcatcaacagtgtgatgtctgatatccgccgcctg
gtgatgtaa

DBGET integrated database retrieval system