KEGG   Edwardsiella ictaluri: NT01EI_0759Help
Entry
NT01EI_0759       CDS       T00912                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00010  Glycolysis / Gluconeogenesis
eic00020  Citrate cycle (TCA cycle)
eic00620  Pyruvate metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
Module
eic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_0759
   00020 Citrate cycle (TCA cycle)
    NT01EI_0759
   00620 Pyruvate metabolism
    NT01EI_0759
Enzymes [BR:eic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NT01EI_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACR67980
UniProt: C5B9H9
Position
760100..761668
Genome map
AA seq 522 aa AA seqDB search
MAIAIKVPDIGADEVEVTEILVKVGDRVDAEQSLITVEGDKASMEVPSPQAGIIRAIKVV
VGDKVTTGSLIMEFEAADAAAAQPAAQVQPAAAPAAAAQVRDVQVPDIGGDEVEVTEILV
KVGDSVSAEQSLITVEGDKASMEVPAPFSGVVQSITIATGDKVKTGSPIMTFSVAGSASV
PSASAPAAALPVSAPTASPVAAPAVVQAESEFTENTAYVHATPVIRRLAREFGVNLARVK
GSGRKGRILREDVQAYVKELIKRAETAPVAAGGALPGLLPWPKVDFSKFGEVEEVELDRI
QKISGANLHRNWVMIPHVTQFDETDITEVEAFRKQQNVESEKRKLGVKITPLVFIIKAVA
KALEAMPRFNSSLSEDAQRLTLKKYINIGVAVDTPNGLVVPVLRDVNKKGIIELSRDLAE
ISAKARAGKLTATDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKE
FAPRLMLPLALSYDHRVIDGADGARFISFINSVMSDIRRLVM
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgcaatcaaggtaccggacatcggtgcggatgaagtagaagtcactgaaatt
ctggtgaaagtcggtgaccgggttgatgcggagcagtcgctgatcaccgttgagggcgac
aaggcttcaatggaggttccctcgccgcaggccggcattatccgcgccatcaaggttgtg
gtgggcgataaggtcacaaccggttctctgatcatggagtttgaggcggcagatgccgcc
gcagcccaaccggcggctcaggtgcagccggcagcggctccggccgccgctgcgcaggtg
cgtgatgttcaggtgccggatatcggtggcgatgaggttgaggtcaccgaaattctggtt
aaggtgggcgacagcgtcagcgctgagcagtcgctgatcaccgtcgaaggcgataaggcc
tcgatggaggttccggcgccgttctccggggtggttcaatccatcactatcgccaccggc
gacaaggtgaagaccggttcgccgatcatgaccttcagcgtggcgggcagcgcgtcagtg
ccgtcggcatctgcgccagcggctgcgctaccggtaagtgcaccgacagcctcaccggtt
gccgcgcctgcggtggtacaggcggagagcgaatttaccgaaaacaccgcctatgtgcat
gcgacgccggtgatccgccgtctggcgcgcgagtttggtgttaacctggccagggtaaaa
ggcagtgggcgtaaaggccgtattctgcgtgaagacgtacaggcttatgtcaaagagctg
attaagcgtgctgaaactgcaccggtggctgccggaggggccctgccgggtctgctgccg
tggccgaaagtggacttcagcaagttcggcgaggtggaagaggttgagctggatcgtatc
cagaagatctccggcgccaacctgcaccgcaactgggtgatgatcccgcatgtcacccag
tttgacgagaccgatattaccgaggtggaagcgttccgcaaacagcagaacgtggagtcc
gagaagcgcaagctgggggttaaaattaccccgctggtgtttatcatcaaggcggtggct
aaggcgctggaggcgatgccgcgctttaacagctccctgtctgaggatgcccagcgtctg
acgctgaagaagtacatcaatatcggtgttgcggtcgatacgccgaacggcctggtggtt
ccggtgctgcgcgacgtcaataagaagggcatcatcgagctgtcgcgcgatctggcggaa
atctcagccaaggcgcgtgccggcaagctgaccgccacggacatgcagggcggctgcttt
accatctctagcttgggtggtatcggcggcacggcgtttacgccgatcgtcaacgcaccg
gaggtggcgatcctgggggtatccaagtcgtcgatgaagccggtatggaatgggaaagag
tttgcgccgcgcctgatgctgccgctggcgctctcctatgaccatcgggttatcgacggt
gccgacggcgcccgctttatcagtttcatcaacagtgtgatgtctgatatccgccgcctg
gtgatgtaa

DBGET integrated database retrieval system