KEGG   Edwardsiella ictaluri: NT01EI_0809Help
Entry
NT01EI_0809       CDS       T00912                                 

Definition
exodeoxyribonuclease V, alpha subunit, putative (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eic  Edwardsiella ictaluri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT01EI_0809
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NT01EI_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812734..814587
Genome map
AA seq 617 aa AA seqDB search
MRESLLSQMAQQRTLRPLDLQFATLLAGPQQPHLALAAALVSQELAAGHVCLPLTALDMA
TLSQRFPQQADAWPALLAGWDVARWRDYLLAQPCVSGGERATPLVVSHECLYLQRLWRDE
GTVAAFFADACAQPRRGDGALAPVLHRLFPATAQRPDWQQVAAAVAVTRRASVISGGPGT
GKTTTVARLLAALVALAPGRMPRIQLAAPTGKAAARLGESLGQALAALALAPDQLQAMPR
EALTLHRLLGARADSARLRYHRDNPLHLDVLVVDEASMVDLPMMARLIEALPPQAQLILL
GDRDQLASVEAGAVLGELCRFAEYGFSATRAAELSQLCAAPIPAGDTQPVVALRDAISLL
RHSYRFDARSGIGQLAQAVNRGHHRMAMACLKDHFTDLHWHEIVQDEDYQTLLTCCLVGY
RPMLEGILRGEAPAQILAEFARFRPLCALREGPFGLHGLNERIALTLQRAGLIRRTHEGQ
KHWYAGRPVMITRNDATQALFNGDIGITLGDELSGWQVWFMGSDGAPRAVQPNRLPPHET
AWAMTVHKSQGSEFDHTLLALPTQPSPVVTRELVYTAITRARRQLTLFATRPVLERAIRT
PTERRSGLMARLLAAAD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtccctactctcccagatggcgcagcagcgtacgctgcgcccgctggatctg
cagtttgccacgctgttggccgggccgcagcagccgcacctggcgctggccgcggcgctg
gtcagccaagagctggccgccgggcatgtctgcctgccgctgacggcgttggatatggcg
acgctgagccagcgctttccacagcaggccgatgcgtggcctgcgctgctcgcaggatgg
gacgtcgcccgctggcgggactacctgctggcgcagccttgcgtcagcggcggcgagagg
gcgacgcctctggtggtgagccacgagtgcctgtatctacagcggctatggcgtgatgag
gggacggtagcggcctttttcgccgacgcttgcgctcaaccgcggcggggcgatggcgcg
ctggcgccggtgctgcatcgtctgttcccggccacggcccagcggccggactggcagcag
gtggccgcggccgtggcggtgacgcgccgggcatcggtgatctctggcggccccggcacc
ggtaagaccacgaccgtagcgcgcctgttggcggcgttggtcgcgctggcgcccggacgg
atgccgcgtattcagctggcggcgccgacgggtaaggcggcggcacgtctgggcgagtcg
ttggggcaggccttggcggcattggcgctggcgccggatcagctacaggcgatgccgcgc
gaagcgctgacgctgcatcgcttgctgggtgcccgcgcagacagcgcccgcttgcgttat
caccgggataatccgctgcatctggatgtgctggtggtggatgaggcgtcgatggtggat
ctgccgatgatggcgcggctgatcgaggcgctgccgccgcaggcgcagctgatcctgctg
ggggatcgcgatcagctggcttcggttgaggccggtgcggtgctgggtgagctgtgccgc
tttgccgaatatggattcagtgccacgcgcgcggccgagctgagccagctgtgcgctgcg
ccgatccccgcaggggatacgcagcctgtggtcgctctgcgtgacgccatcagcctgctg
cgtcacagctaccgctttgacgcccgttcaggtatcggtcagctggcgcaggccgtcaat
cggggccatcaccggatggcgatggcgtgcctgaaggaccattttaccgacctgcactgg
cacgaaatcgtccaggatgaagactaccagacgctcttaacgtgctgtctggtggggtat
cgtccgatgctggaggggatcctgcgcggggaggcaccggcgcagatcctggctgagttt
gcccgcttccgtcccctgtgtgccctgcgtgaggggccctttggcctgcatggtctcaac
gagcgtatcgccctgacgctgcagcgggcggggttgatccggcgcacgcatgaggggcaa
aagcactggtatgccgggcgcccggtgatgatcacccgcaacgacgccactcaggcgctg
tttaacggtgatatcggtattacgctgggcgatgagctgagcggctggcaggtgtggttt
atgggcagcgatggcgctccgcgcgcggtgcagcccaaccggctaccgccccatgagacg
gcctgggcgatgacggtacacaagtcgcagggatcggagttcgaccatacgctgctggcg
ttgccgacccagccgtcaccggtggtgacgcgtgagctggtgtataccgctatcacacgg
gcacggcggcagctgacgctctttgcgacccggccggtgttggagcgggctatccgcacg
ccgaccgagcggcgcagcgggttaatggcccgtctgctggccgccgccgattaa

DBGET integrated database retrieval system