KEGG   Edwardsiella ictaluri: NT01EI_0915Help
Entry
NT01EI_0915       CDS       T00912                                 

Definition
glutamate 5-kinase, putative (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
eic  Edwardsiella ictaluri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01EI_0915
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NT01EI_0915
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NT01EI_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916146..917252
Genome map
AA seq 368 aa AA seqDB search
MTSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREH
LGYPDLPATIASKQLLAAVGQSSLIQLWQQLFAIYGIHIGQVLLTRADMEDRERFLNARD
TLHALMDNRIIPVINENDAVATAEIKVGDNDNLSALAAILAGANKLLLLTDQAGLFTADP
RHNPAAELIREVTGIDDALRGIAGDSVSGLGTGGMTTKLQAADVACRAGIEVVIAAGSRP
GVIGEVIDGISVGTRFHPLQTPLENRKRWIFGAPPAGEIVVDDGALEAIVTRGSSLLPKG
IREVSGDFSRGEVVRIRTLDGRDLAHGVSRYNSDALRMIAGHHSLQISAILGYEYGPVAV
HRDDMIVS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtggcagtcagaccctggtggtaaagctgggcaccagcgtgttgaccggtggc
tcccgccgcctcaaccgcgcccatatcgtagaattggtccggcagtgtgcccagcagcac
gccgcgggacaccgtattgtgatcgtgacctccggggcgatcgccgccgggcgcgagcac
ctgggctacccggatctgccggcgaccatcgcctctaagcagctgctggcggcggtgggg
cagagcagcctgatccagctgtggcagcagctgttcgccatctacggcatccatattggt
caggtgctgctgacccgcgccgatatggaggatcgcgaacgcttcctcaacgcccgcgat
accctgcacgccctgatggacaaccgtatcattccggtgatcaacgaaaacgacgcggtc
gccacggcggagatcaaggtgggtgacaacgacaatctgtcggcgctggcggcgatcctg
gccggggccaacaaactgctgctgctgaccgatcaggccgggctgtttaccgccgatccg
cgccataacccggcggcagagctgatccgtgaagtgaccggtatcgacgatgcgctgcgc
ggcatcgccggcgacagcgtctccgggctgggcaccggcggtatgaccaccaagctgcag
gccgccgacgtggcctgccgcgccgggattgaggtggttatcgccgcgggcagccgtccc
ggcgtgatcggcgaggttatcgacggtatctccgtcggcacccgctttcaccccctgcag
acgccgctggaaaaccgcaagcgctggatctttggcgccccgccggccggtgaaatcgtg
gtggacgacggcgcgctggaggcgatcgtcacccgcggcagctcgctgttgcccaagggg
atccgcgaagtgagcggtgacttttcccgcggtgaggtggtgcgcatccgcacgctggac
gggcgcgatctggcgcacggcgtctcccgctacaacagcgatgcgctgcgcatgattgcc
ggccaccattcgctgcaaatcagtgcgatcctcggctatgaatatggcccggtagccgta
catcgtgacgatatgatcgtcagctaa

DBGET integrated database retrieval system