KEGG   Edwardsiella ictaluri: NT01EI_1110Help
Entry
NT01EI_1110       CDS       T00912                                 

Definition
recombination protein RecR, putative
Orthology
K06187  
recombination protein RecR
Organism
eic  Edwardsiella ictaluri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT01EI_1110
DNA repair and recombination proteins [BR:eic03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NT01EI_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105449..1106054
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCRDC
RTFTEQEVCTICTNARRRENGQICVVESPADIHAIEQTGQYSGRYFVLMGHLSPLDGIGP
QDIGLDRLEVRLSQEAVSEVILATNPTVEGEATANYIAEMCAAHGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPVTR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagcccgcttcttgaatcgctgatggaggcgctgcgctgcttgcccggcgtc
ggcccaaagtcggcccagcgtatggcgtttcacctgctgcagcgcgatcgcagcggagga
atgcgtctggcgcaggcgctgacgcgcgcgatgtcggagatcggacactgccgggactgc
cgcaccttcaccgagcaggaggtctgtactatctgtactaacgcgcgtcggcgtgagaat
ggacagatctgcgtagtggagagcccggcggatattcatgccattgagcagaccgggcag
tactctgggcgctatttcgtgctgatggggcacctctctccactggacggtatcggtcca
caggatattggtctggacaggctggaggtgcggctgagccaagaggcggtcagcgaagtg
atcctcgccactaacccaacggttgagggtgaggcgactgccaattacatcgcggaaatg
tgtgcggcgcacggtgtgctggccagccgaatcgcccacggcgtgccggtggggggcgag
ctggagatggtcgacggtaccactctgtcccactctttggccgggcgtcacccggtgacg
cgctga

DBGET integrated database retrieval system