KEGG   Edwardsiella ictaluri: NT01EI_1119Help
Entry
NT01EI_1119       CDS       T00912                                 

Definition
isocitrate lyase, putative (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eic  Edwardsiella ictaluri
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eic01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eic00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113631..1114959)
Genome map
AA seq 442 aa AA seqDB search
MKIRTQQIEELQKEWTQPRWNGITRSYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWSTGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELAQR
FADAIHAKFPGKLLAYNCSPSFNWQKNLDDKTIASFQQRLSDMGYKYQFITLAGIHSMWF
NMFDLAHSYAQGEGMRYYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGSS
SVTALTGSTEESQFGSISDGRN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgtactcaacaaatcgaggaattacagaaagaatggactcaaccgcgctgg
aatggcatcacccgctcatatagcgcggaggatgtggtgaaattacgtggctcggtcaac
ccggaatgcacactggcgcagcttggcgcggcaaaaatgtggcgtctgctgcacggagaa
tcaaagaaaggttatatcaacagcctcggcgcgctgaccggcggtcaggcgctgcagcag
gcgaaagccgggattgaagcggtctacctttcgggctggcaggtggcagcagatgctaac
ctggcatccagcatgtacccagaccaatcgctgtatccggcaaactctgtcccggcggtg
gtggatcggatcaacaacacattccgtcgtgccgatcagatccaatggtcaacaggtatt
gagccaaacgatccgcgctacgtggattacttcctgccaatcgttgccgatgcggaagcg
ggttttggcggagtactgaacgcgtttgaactgatgaagtcgatgattgaggctggtgca
gcggccgttcacttcgaagatcagctcgcatcggtgaaaaaatgtggtcacatgggcggc
aaagtcctggtgccgactcaggaagccatccagaaactggtggcagctcgtctggctgca
gacgtcatgggtgtaccgacgctggtgattgcgcgtaccgatgctgacgcagccgatttg
attacttctgattgcgacccatacgacagcgagttcatcaccggcgaacgtaccagcgaa
ggattctaccgcacgcatgcgggcattgagcaagcgatcagccgtggtctggcctacgca
ccgtatgcggatttggtgtggtgtgaaacctccacgccggacctcgaactggcgcagcgc
tttgccgatgctatacatgcgaaattcccgggtaaactgttggcctacaactgttcaccg
tcgtttaactggcagaaaaacctggatgacaaaaccattgccagcttccagcagcgactg
tcagatatgggctacaaataccagttcatcaccctggcgggcatccacagcatgtggttc
aacatgttcgacctcgctcattcttatgcgcagggtgaaggtatgcgctactacgttgag
aaagttcagcagccagaatttgcggcggctaaagacggttacactttcgtatcccatcag
caggaagttggtacaggctatttcgacaaagtaaccactatcattcagggaggctcctcc
tcggtgacagcattaactggttccactgaagaatcgcagtttggatcaatatccgatggg
agaaattga

DBGET integrated database retrieval system