KEGG   Edwardsiella ictaluri: NT01EI_1120Help
Entry
NT01EI_1120       CDS       T00912                                 

Definition
malate synthase A, putative (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eic  Edwardsiella ictaluri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eic01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eic00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eic00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1114995..1116596)
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDELVFTRPHGEQEQQILTAEAVGFLTSLVTRFTPKRNKLLAARIQQQQDIDD
GKLPDFISETNSIRDGDWKIRDIPDDLLDRRVEITGPVERKMLINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTSEAGKIYQLKPNPALLMCRVRGLHLPEKHVTWR
GESIPGSLFDFALYFFHNYKTLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNHQVLTKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNDVLGENKNQLFVTREEDAPITAEQLLAPCKGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKLVTKSLFR
QMLAEEMLVIQNELSEHRYSRGRFDDAAHLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacgacaaccgatgaactggtcttcaccaggccgcatggcgaacag
gaacagcaaattctgaccgctgaagcggtggggtttctaaccagtctggtgacaagattt
acgccaaaacggaataagcttctggctgcacgtatccagcagcagcaggatattgatgac
ggtaagttgcctgattttatttcggaaaccaattccattcgtgatggtgactggaaaatt
cgcgatattcctgatgatttactggatcgtcgtgtagagatcaccgggcccgttgagcgc
aaaatgctcatcaatgcgctgaacgcgaacgtcaaagtctttatggctgattttgaagat
tcactggcccccgaatggagcaaagttatcgacgggcagatcaatctgcgcgatgcggtc
aatggcaccattagctacaccagcgaagccggtaaaatttatcaactgaaacccaatccg
gccctgttgatgtgtcgcgttcgcggtctgcacctgccggaaaaacacgtcacctggcgc
ggagaatccatcccgggcagcctgttcgactttgctctctatttcttccacaactacaaa
acgttgttggcaaaaggcagcggcccctatttctatctgccaaaaacgcaggcctggcaa
gaagcggcatggtggagcgaagtgttcagctatgcagaggatcgctttaatctgccgcgc
ggtaccatcaaagcgaccctgctgattgaaacgctgccagccgttttccagatggatgag
atcctgcatgcgctgcgtgaccacattgtgggcctgaactgcggtcgctgggactacatt
ttcagctatatcaaaaccctgaagaaccacccggatcgcgtgctgccggaccgtcaggta
gtgacgatggataagccatttctcagcgcctattcgcgtctgctgattaaaacttgtcat
aaacgcggtgcgttcgcgatgggcggcatggcagcgttcattcccagtaaagatgcggaa
cgtaaccaccaggttctgactaaggtaaaagcggacaaagcgctggaagcaaataacggt
catgacggcacatggattgcccatccgggactggcagacacggcaatggctgtgttcaac
gacgtactcggtgaaaataaaaatcagctgttcgtgacccgtgaagaagatgcgccgata
accgcagaacaactgctggcaccctgcaaaggtgagcgcacggaagaaggtatgcgcgcc
aacatccgtgtcgctgtgcagtacatcgaagcgtggatctccggtaacggctgcgtaccg
atttacggcctgatggaagatgcggccactgctgaaatctcccgtacctccatctggcag
tggatccaccaccagaaaacgctcagtaacggcaagctggttaccaagtcgttgttccgc
cagatgctggccgaagagatgctggtgatccagaacgagctgagcgaacaccgctacagc
agaggacgttttgacgatgccgcgcacctgatggagcaaatcaccacttccgatgagtta
attgatttcctgacgttaccgggctaccgccttttggcctaa

DBGET integrated database retrieval system