KEGG   Edwardsiella ictaluri: NT01EI_1120Help
Entry
NT01EI_1120       CDS       T00912                                 

Definition
(RefSeq) malate synthase A, putative (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eic  Edwardsiella ictaluri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_1120
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NT01EI_1120
   00630 Glyoxylate and dicarboxylate metabolism
    NT01EI_1120
Enzymes [BR:eic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NT01EI_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1114995..1116596)
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDELVFTRPHGEQEQQILTAEAVGFLTSLVTRFTPKRNKLLAARIQQQQDIDD
GKLPDFISETNSIRDGDWKIRDIPDDLLDRRVEITGPVERKMLINALNANVKVFMADFED
SLAPEWSKVIDGQINLRDAVNGTISYTSEAGKIYQLKPNPALLMCRVRGLHLPEKHVTWR
GESIPGSLFDFALYFFHNYKTLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNHQVLTKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNDVLGENKNQLFVTREEDAPITAEQLLAPCKGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKLVTKSLFR
QMLAEEMLVIQNELSEHRYSRGRFDDAAHLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacgacaaccgatgaactggtcttcaccaggccgcatggcgaacag
gaacagcaaattctgaccgctgaagcggtggggtttctaaccagtctggtgacaagattt
acgccaaaacggaataagcttctggctgcacgtatccagcagcagcaggatattgatgac
ggtaagttgcctgattttatttcggaaaccaattccattcgtgatggtgactggaaaatt
cgcgatattcctgatgatttactggatcgtcgtgtagagatcaccgggcccgttgagcgc
aaaatgctcatcaatgcgctgaacgcgaacgtcaaagtctttatggctgattttgaagat
tcactggcccccgaatggagcaaagttatcgacgggcagatcaatctgcgcgatgcggtc
aatggcaccattagctacaccagcgaagccggtaaaatttatcaactgaaacccaatccg
gccctgttgatgtgtcgcgttcgcggtctgcacctgccggaaaaacacgtcacctggcgc
ggagaatccatcccgggcagcctgttcgactttgctctctatttcttccacaactacaaa
acgttgttggcaaaaggcagcggcccctatttctatctgccaaaaacgcaggcctggcaa
gaagcggcatggtggagcgaagtgttcagctatgcagaggatcgctttaatctgccgcgc
ggtaccatcaaagcgaccctgctgattgaaacgctgccagccgttttccagatggatgag
atcctgcatgcgctgcgtgaccacattgtgggcctgaactgcggtcgctgggactacatt
ttcagctatatcaaaaccctgaagaaccacccggatcgcgtgctgccggaccgtcaggta
gtgacgatggataagccatttctcagcgcctattcgcgtctgctgattaaaacttgtcat
aaacgcggtgcgttcgcgatgggcggcatggcagcgttcattcccagtaaagatgcggaa
cgtaaccaccaggttctgactaaggtaaaagcggacaaagcgctggaagcaaataacggt
catgacggcacatggattgcccatccgggactggcagacacggcaatggctgtgttcaac
gacgtactcggtgaaaataaaaatcagctgttcgtgacccgtgaagaagatgcgccgata
accgcagaacaactgctggcaccctgcaaaggtgagcgcacggaagaaggtatgcgcgcc
aacatccgtgtcgctgtgcagtacatcgaagcgtggatctccggtaacggctgcgtaccg
atttacggcctgatggaagatgcggccactgctgaaatctcccgtacctccatctggcag
tggatccaccaccagaaaacgctcagtaacggcaagctggttaccaagtcgttgttccgc
cagatgctggccgaagagatgctggtgatccagaacgagctgagcgaacaccgctacagc
agaggacgttttgacgatgccgcgcacctgatggagcaaatcaccacttccgatgagtta
attgatttcctgacgttaccgggctaccgccttttggcctaa

DBGET integrated database retrieval system