KEGG   Edwardsiella ictaluri: NT01EI_1269Help
Entry
NT01EI_1269       CDS       T00912                                 

Definition
glucokinase, putative (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:eic01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eic00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eic00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eic00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eic00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:eic00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1250563..1251528
Genome map
AA seq 321 aa AA seqDB search
MSRFALVGDVGGTNARLALCCLDTGSLEAVQSYPGQQFDSLESVIRTYLQAQAVSVTSAC
IAIACPITGDRVAMTNHSWAFSISAMQRSLGLAHLSVINDFTAVSMAVPVLPAESLLQLG
GQTVQPDRPIAIYGAGTGLGVAHLIRAGERWISLPGEGGHVDFATGSDEEDALLAALRTD
LGRVSAERVLSGPGLVNLYRAVARVAGRTPQPLTPQEVSERALADHCPDCRRALSLFCVM
MGRFGGNLALNMGTFGGVYIAGGIVPRFLAFFRDSGFRQAFEDKGRFKAYLAPIPVFLIV
HDNPGLLGAGAYLRQHLGARL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgcgttggttggtgatgtgggtgggaccaatgcccgcctggcgctgtgt
tgcctcgatacgggctctctcgaggcggtgcagagctacccgggacagcagtttgatagc
ctggagtcggtcatccggacctacctgcaggcgcaggcggtatcggtgacgtcggcctgc
atcgccatcgcctgtccgatcaccggcgatcgcgtggcgatgaccaatcacagctgggcg
ttttccatcagcgcgatgcagcgctctctggggctggcgcatctgtcggtgatcaacgac
tttaccgcggtctctatggcggtgccggttctccctgcggagagtctgctgcagttgggc
ggtcagacggtgcagccagatcggcctatcgccatctacggcgccggtaccgggctgggc
gtcgctcacctgatccgggccggggagcgctggatcagcctgccgggagagggaggtcac
gtggacttcgcgaccggcagtgatgaagaggacgcactgctggcggcgctgcgcactgat
ctggggcgggtctctgccgagcgggtgctctcagggcctggtctggtcaatttgtatcgt
gccgtcgcccgggttgcgggacggacgcctcagcccctgacgccacaggaggtcagcgag
cgggcgctggctgaccactgcccggactgtcggcgggcgctgtcactgttctgtgtgatg
atggggcgctttggcggcaatctggcgctgaatatgggcacctttggtggggtgtatatc
gccggtgggatcgtgccgcgttttctggcttttttccgcgactccggctttcgtcaggcg
tttgaggacaaggggcgctttaaggcgtaccttgcgccgatcccggtctttctgatcgtg
catgataaccccggcctgcttggtgccggagcctacctgcgtcagcacttaggcgcccgc
ctctag

DBGET integrated database retrieval system