KEGG   Edwardsiella ictaluri: NT01EI_1269Help
Entry
NT01EI_1269       CDS       T00912                                 

Definition
(GenBank) glucokinase, putative
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00010  Glycolysis / Gluconeogenesis
eic00052  Galactose metabolism
eic00500  Starch and sucrose metabolism
eic00520  Amino sugar and nucleotide sugar metabolism
eic00521  Streptomycin biosynthesis
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
Module
eic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eic_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_1269
   00052 Galactose metabolism
    NT01EI_1269
   00500 Starch and sucrose metabolism
    NT01EI_1269
   00520 Amino sugar and nucleotide sugar metabolism
    NT01EI_1269
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NT01EI_1269
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NT01EI_1269
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NT01EI_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACR68466
UniProt: C5BCK8
Position
1250563..1251528
Genome map
AA seq 321 aa AA seqDB search
MSRFALVGDVGGTNARLALCCLDTGSLEAVQSYPGQQFDSLESVIRTYLQAQAVSVTSAC
IAIACPITGDRVAMTNHSWAFSISAMQRSLGLAHLSVINDFTAVSMAVPVLPAESLLQLG
GQTVQPDRPIAIYGAGTGLGVAHLIRAGERWISLPGEGGHVDFATGSDEEDALLAALRTD
LGRVSAERVLSGPGLVNLYRAVARVAGRTPQPLTPQEVSERALADHCPDCRRALSLFCVM
MGRFGGNLALNMGTFGGVYIAGGIVPRFLAFFRDSGFRQAFEDKGRFKAYLAPIPVFLIV
HDNPGLLGAGAYLRQHLGARL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgcgttggttggtgatgtgggtgggaccaatgcccgcctggcgctgtgt
tgcctcgatacgggctctctcgaggcggtgcagagctacccgggacagcagtttgatagc
ctggagtcggtcatccggacctacctgcaggcgcaggcggtatcggtgacgtcggcctgc
atcgccatcgcctgtccgatcaccggcgatcgcgtggcgatgaccaatcacagctgggcg
ttttccatcagcgcgatgcagcgctctctggggctggcgcatctgtcggtgatcaacgac
tttaccgcggtctctatggcggtgccggttctccctgcggagagtctgctgcagttgggc
ggtcagacggtgcagccagatcggcctatcgccatctacggcgccggtaccgggctgggc
gtcgctcacctgatccgggccggggagcgctggatcagcctgccgggagagggaggtcac
gtggacttcgcgaccggcagtgatgaagaggacgcactgctggcggcgctgcgcactgat
ctggggcgggtctctgccgagcgggtgctctcagggcctggtctggtcaatttgtatcgt
gccgtcgcccgggttgcgggacggacgcctcagcccctgacgccacaggaggtcagcgag
cgggcgctggctgaccactgcccggactgtcggcgggcgctgtcactgttctgtgtgatg
atggggcgctttggcggcaatctggcgctgaatatgggcacctttggtggggtgtatatc
gccggtgggatcgtgccgcgttttctggcttttttccgcgactccggctttcgtcaggcg
tttgaggacaaggggcgctttaaggcgtaccttgcgccgatcccggtctttctgatcgtg
catgataaccccggcctgcttggtgccggagcctacctgcgtcagcacttaggcgcccgc
ctctag

DBGET integrated database retrieval system