KEGG   Edwardsiella ictaluri: NT01EI_1277Help
Entry
NT01EI_1277       CDS       T00912                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eic  Edwardsiella ictaluri
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT01EI_1277
Enzymes [BR:eic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NT01EI_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261449..1262111
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRGEPLARDTRKAQIEAHMTEVMRLLNLDLSDDSLVE
TPSRIAKMYVDEIFSGLDYANFPKITIIENKMDVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKERVIGLSKINRIVRFFAQRPQVQERLTQQILVALQTLLGTKNVAVSIDAVHYC
VKARGVRDATSATTTTSLGGLFKTSQNTRQEFLRAVRHHV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgcactggtgcacgaggcgctgctggcgcgcgggttg
gaaactccactgcgcggcgagccgctggcgcgcgatacgcgcaaggcgcagattgaggcg
cacatgaccgaggtcatgaggctgttgaatctggatctgtcggatgacagccttgtagag
acaccgtcgcggatcgccaaaatgtacgtggacgaaattttttccggcctggattacgcc
aactttcctaaaatcaccattattgaaaataagatggatgtcgatgagatggtgacggtg
cgcgatattacgctgaccagcacctgcgaacaccatttcgtcaccatcgatggcaaggcg
acggtcgcctacatcccgaaagagagggtgattgggctgtccaagatcaaccggattgtc
cgcttttttgcccagcgcccacaggtacaggagcggttgacccagcaaatcctggtggcg
ctgcagacgctgctggggaccaagaacgtcgccgtctccatcgatgcggtgcactactgc
gtcaaagcccgcggcgtacgcgatgcgaccagcgcgaccaccaccacctcgctgggcggg
ctgtttaaaaccagtcaaaatacccgccaggagtttctgcgcgcggtgcgtcaccacgtt
tag

DBGET integrated database retrieval system