KEGG   Edwardsiella ictaluri: NT01EI_1310Help
Entry
NT01EI_1310       CDS       T00912                                 

Definition
nucleotidyl transferase family protein (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eic  Edwardsiella ictaluri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NT01EI_1310
   00052 Galactose metabolism
    NT01EI_1310
   00500 Starch and sucrose metabolism
    NT01EI_1310
   00520 Amino sugar and nucleotide sugar metabolism
    NT01EI_1310
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NT01EI_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1301188..1302090
Genome map
AA seq 300 aa AA seqDB search
MTSLKAVIPVAGLGMKMLPATKAIPKEMLPIVDKPLIQKVVHECLSAGVKEIILVTHSSK
NTIENHFDTSFELEALLEARVKRQLLDEVRSICPPGVTINSVRQHRQLGLGHAILCARPL
VGEHPFIVALPDIWLDASTFDPETQNLAAMVRRFEESGRSQVLVQPMPLEALPEYSVINC
ADAVLEPGQSACMTSIVEKPEDAEKYHSDLSAVGRYVLSAAIWPILAATGFGAWERIQLS
DAIATLLQHRPVEAYRQVGLSYDCGDKLGYAEAFVAGGLNHSQQGAAFTAWLQDVQTRIE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcttaaagccgttatccccgtcgccggactggggatgaagatgttgccggcc
accaaggccatcccgaaagagatgctgcccattgttgataagccgctgattcagaaagtt
gtccatgagtgtttgtccgccggggtgaaagagatcatcctggtcacccattcatccaag
aataccattgagaaccacttcgatacttcctttgagctggaagcgctgctcgaggcgcgc
gttaagcgccagttgctggatgaggtacgttccatctgccctcccggggtgacgattaac
agcgtgcgtcagcataggcagctgggtctgggacatgccattctttgtgcccgtcctctg
gtgggagaacatccttttatcgtcgcgctgccggatatctggttagatgccagtaccttc
gatcctgaaacccagaatctggcagcgatggtcaggcgctttgaggagagcgggcgcagc
caggtgctggtgcagccgatgccgctggaggctttgccggagtattcggtgattaactgt
gccgatgcggtgctggaaccggggcagagtgcgtgtatgacctcgattgtcgaaaaacct
gaggatgcggaaaagtaccactccgatctgtcggcggtcgggcgctacgtcttgtcggcc
gccatctggccgattttagctgccaccggctttggcgcctgggagcgcatccagctctcc
gacgctattgcaaccctgttgcagcaccgtccggtcgaggcctaccgtcaggtggggcta
tcctatgactgtggcgataaattggggtatgctgaggcctttgtcgccggtgggttaaat
cactctcagcagggagcggcctttaccgcctggctgcaggatgtgcagacgcgaattgaa
tga

DBGET integrated database retrieval system