KEGG   Edwardsiella ictaluri: NT01EI_1464Help
Entry
NT01EI_1464       CDS       T00912                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase, putative (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eic  Edwardsiella ictaluri
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eic00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NT01EI_1464
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NT01EI_1464
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NT01EI_1464
Two-component system [BR:eic02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   NT01EI_1464
Bacterial motility proteins [BR:eic02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NT01EI_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1440461..1441513
Genome map
AA seq 350 aa AA seqDB search
MNKIRVLCVDDSALMRQLMTEIVNSHPDMEMVAVAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIADKIRTAARARLPRPLKQSAPPATLSHGPLLSSEKLIAIGASTGGTEAIRHVLQPLP
ATSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERILPGHAYIAPGAHHLELARS
GANYIVRLHQGPPVNRHRPSVEVLFDSVARCAGRNAVGVILTGMGNDGAAGMLRLHQAGA
YTIAQNEASCVVFGMPREAIQMGGVDEVVDLSQISQRMLAQVSAKQALRI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatcagagtattgtgcgtagatgactccgcgctgatgcgccaattgatgacc
gagatcgtgaacagtcaccccgatatggagatggtggccgttgcgcaggacccgttggtc
gcgcgggatctgatcaaaaaattcaatcctcaggtactgacactggatgttgaaatgccg
cgcatggacggcctcgactttttggagaaactgatgcgcctgcgcccgatgccggtggtg
atggtctcctccctgaccgggaagggatcggagatcaccctgcgggcgctggagctgggc
gcggtggactttgtgaccaagccgcagctggggatccgcgaagggatgctggcctatagc
gagctgatcgccgacaagatccgcaccgccgcgcgcgcgcgtctgccgcgcccgctgaag
cagagcgcgccgccggcgaccctgagccacggcccgctgctcagcagcgaaaagctgatc
gccatcggtgcctctaccggtggtaccgaggcgattcgccacgtgctgcagccgctgccg
gcgaccagcccggcgctgctgatcacccagcatatgccgccgggctttacccgctctttc
gccgagcggctgaacaagctgtgccagatcacggtaaaagaggccgaggacggcgaacgc
attctgccggggcatgcctatattgcccccggcgctcaccatctggagctggcgcgcagc
ggcgccaactatatcgtgcgtctgcatcaggggccgccggtgaaccgtcatcgtccctct
gtcgaggtactgtttgactccgtcgcccgctgtgccggccgcaacgccgtaggggtgatc
ctgacggggatgggcaacgatggcgctgcggggatgctgcggctacaccaggcgggcgcc
tacaccattgcgcagaatgaagccagctgcgtggtgtttggtatgccgcgcgaggcgatt
cagatgggcggggtcgatgaagtggtcgacctctcccaaatcagccagcgtatgctggca
caggtcagcgccaagcaggcgctgcgcatttaa

DBGET integrated database retrieval system