KEGG   Edwardsiella ictaluri: NT01EI_1561Help
Entry
NT01EI_1561       CDS       T00912                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase, putative
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00900  Terpenoid backbone biosynthesis
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01130  Biosynthesis of antibiotics
Module
eic_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT01EI_1561
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NT01EI_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACR68747
UniProt: C5B811
Position
complement(1522575..1523453)
Genome map
AA seq 292 aa AA seqDB search
MIDALTHWPAPAKLNLFLYITGRRADGYHLLQTLFQFVDYGDTLTIQARGDDQLRLLTPV
AGVADEDNLIIRAARALRAALPPAFAGCGADIALQKILPMGGGLGGGSSDAATTLVALNT
LWQAGLSDARLAEIGLTLGADVPVFVNGVAAFAQGVGELLQTAHPEEKWYFVAHPGISIP
TPVIFADPALKRDSPIRTLTELLATPYSNDCEPIARKRFREVEQALSWLLEYAPSRLTGT
GACVFAEFDTEQAARQVLSIAPEWMQGFVARGINRSPLHHARSELLASIARN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgcgctgacccactggccggcaccggccaagctgaatctgtttctttacatc
accgggcggcgggccgacggctaccatctgctgcagaccctgttccagtttgtggactac
ggcgacacgctcaccattcaggcccgcggtgacgaccagctgcgtctgctgacaccggtg
gcaggagtggcggatgaggataacctgatcatccgcgcggcgcgggcgctgcgggcggcg
ctaccgcccgcctttgccggatgcggcgccgacatcgcactgcaaaagattctgccgatg
gggggcgggctcggcggcggctcatcggatgcggccaccaccctggtcgcgctgaatacc
ctgtggcaggccggattaagcgatgcgcgcctggccgagattggattgaccctgggcgca
gacgtacctgtttttgttaatggcgttgccgcctttgcgcagggtgttggagaattgtta
cagacagcacatcctgaagaaaaatggtactttgttgcacatccaggtatcagcattcct
acgccagtgatcttcgccgatcctgcactgaaaagagactctccaatcagaactttgact
gaactgttggcaacaccatacagtaatgattgcgagccaatagcaagaaaacgttttcgt
gaggttgaacaggcgctttcgtggctgttagaatacgcgccgtcgcgtctgacagggacc
ggcgcctgtgtgtttgcggaattcgacaccgagcaggcggcccgtcaggtgctcagcatt
gcccccgagtggatgcagggattcgtggcgcgtggcatcaataggtcgccgctgcaccat
gcccgctccgagctgctggcctctatagcacgtaactga

DBGET integrated database retrieval system