KEGG   Edwardsiella ictaluri: NT01EI_1598Help
Entry
NT01EI_1598       CDS       T00912                                 

Definition
holliday junction DNA helicase RuvA, putative (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eic  Edwardsiella ictaluri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eic00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NT01EI_1598
Enzymes [BR:eic01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NT01EI_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1559485..1560099
Genome map
AA seq 204 aa AA seqDB search
MRVIGRLRGTILEKQPPQVVLEAHGVGYEVQMPMTCFYELPQVGSEAVIFTHFVVREDAQ
LLYGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAVEREEVAALVKLPGVGK
KTAERLVVEMKDRFKGLSGDLFTPADAQLPSAQPQAQADAEGEAVAALIALGYKPQEASR
LVNRVAVAGADSETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgattggtcgcctcagaggtactattctggaaaaacagccgccgcaggtggtg
ctggaagcccacggtgtcgggtatgaggtgcagatgccgatgacctgcttttatgagttg
ccacaggtcggcagtgaagcggtgatctttacccactttgtggtgcgcgaggatgcccag
ctgctgtatggcttcaacaataagcaggagcgtgcgctgtttcgtgaactgatcaaagtc
aacggcgttgggcctaagctggcgctggcgatcctgtccgggatgtcggcccagcagttt
gtcacggcggttgagcgtgaagaggttgcggcgctggtcaagctgccgggcgtgggcaag
aaaacggctgagcggctggtggtcgagatgaaggaccgcttcaaggggctgagcggcgat
ctgttcaccccggcggatgcgcagctgccgagtgcccagcctcaggctcaggcggatgct
gagggcgaggcggttgccgcgctgatcgcgctgggctacaagccgcaggaggccagtcgc
ttggtgaaccgggtggcggtggccggtgctgacagtgaaaccctgatccgcgacgcgctg
cgcgctgcgctgtaa

DBGET integrated database retrieval system