KEGG   Edwardsiella ictaluri: NT01EI_1644Help
Entry
NT01EI_1644       CDS       T00912                                 

Definition
isochorismatase family protein (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eic  Edwardsiella ictaluri
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NT01EI_1644
Enzymes [BR:eic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NT01EI_1644
    3.5.1.-  
     NT01EI_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1605685..1606320)
Genome map
AA seq 211 aa AA seqDB search
MSAALLLIDLQNDFCPHGALAVPQGDEVIPVALQAVAMARRDGTPVIATQDWHPAEHGSF
ASRSGGQMGEVGKLNGLPQVWWPDHCVQNTIGAAFHPALRNTAFDFVVHKGTDAAVDSYS
AFFDNGQRGATALDAWLRQHGITRLWLLGLATDYCVKFSVLDALRLGYQVNIISDGCRGV
DLTPGDSERALAGMVKAGAALTPLTTLSHLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgcacttttgctgatcgatctacagaatgatttttgcccccatggcgcgctg
gcggttccccagggcgatgaggtcatccctgtcgccctgcaggcggtcgccatggcgcgt
cgggatggcaccccagtaatcgcaacccaggattggcacccggcggaacacggcagcttc
gccagccgcagcggcggacagatgggtgaggtcggcaagctcaatgggctgccccaggtc
tggtggcctgaccactgcgtgcagaacaccatcggtgccgcgtttcacccagccctgcgc
aataccgccttcgattttgtggtgcataagggaaccgatgctgcggtagacagctatagc
gcctttttcgataacgggcagcgcggtgccaccgcgctggatgcctggctgcgccagcac
ggtatcacccgcctgtggctactgggtctggcaacagattactgtgtgaagttttcggtg
ttggacgccctgcgcctgggctatcaggtcaatatcattagcgacggctgccgcggcgtg
gatctcactcccggcgatagcgaacgcgcgctggccgggatggtaaaagccggggcagcc
ctaacccccctcaccacgctcagccacctgcgctga

DBGET integrated database retrieval system