KEGG   Edwardsiella ictaluri: NT01EI_1662Help
Entry
NT01EI_1662       CDS       T00912                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase, putative (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eic  Edwardsiella ictaluri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NT01EI_1662
   00052 Galactose metabolism
    NT01EI_1662
   00500 Starch and sucrose metabolism
    NT01EI_1662
   00520 Amino sugar and nucleotide sugar metabolism
    NT01EI_1662
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NT01EI_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1620360..1621271
Genome map
AA seq 303 aa AA seqDB search
MSTSVRKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLAEVQAICPKHVTIMQVRQGLAKGLGHAIL
CAHPLVGDEPFAVILPDVILDEYSADLSSDNLSEMLRRYESTGASQIMVEPVPMADVSNY
GVVDCCGAQLTAGESIAIRAVVEKPPRDKAPSNLSIVGRYVLSPDIWPLLSKTPPGAGEE
IQLTDAIAMLLKNETVEAYHLKGRSHDCGNKLGYMQAFVEYGLRHPALGEDFAAWIKGLN
LSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtcagtgagaaaagtaaaaaaagccgtgattccggtggctggattgggaacg
cgtatgctgccggcaacgaaagctattccgaaagaaatgttgccgctggtagataagccg
ctgatccagtatgtggtgaatgagtgtattgccgccggtattaatgagatcattttagtc
acgcattcatcgaagaactccatcgagaaccactttgataccagctttgagctggaggct
atcctggagaagcgcgttaagcgtcagctgctggccgaggttcaggctatttgtcccaaa
cacgtgactattatgcaagtgcgtcaggggttggctaaaggtttaggtcacgctattcta
tgcgcacatccgctggtgggcgatgagccttttgccgtgatattgcctgacgttattttg
gatgagtacagcgcagatttaagcagcgataacctgagtgagatgctgcgtcgctatgag
tccaccggtgccagccagattatggttgaaccggtgccgatggccgatgtatctaattat
ggtgtggtggattgctgcggtgcgcaattgactgcaggggaaagcattgctattcgcgcg
gtggtcgaaaaaccgccacgcgataaggcaccgtctaatctgtctatcgttggccgctat
gttctttctccggatatttggccattgctgtctaaaactccaccgggagctggtgaggaa
attcagctaacggatgcgattgccatgctgctgaagaatgaaaccgttgaggcttaccac
ctgaaagggcgtagccatgactgtggaaataagctgggctatatgcaggcgtttgttgag
tatggactgcgtcatcctgcgttgggtgaagattttgcggcctggatcaaggggctgaat
ttaagcaagtaa

DBGET integrated database retrieval system