KEGG   Edwardsiella ictaluri: NT01EI_1665Help
Entry
NT01EI_1665       CDS       T00912                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase 2, putative
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00010  Glycolysis / Gluconeogenesis
eic00071  Fatty acid degradation
eic00350  Tyrosine metabolism
eic00620  Pyruvate metabolism
eic00625  Chloroalkane and chloroalkene degradation
eic00626  Naphthalene degradation
eic00650  Butanoate metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_1665
   00620 Pyruvate metabolism
    NT01EI_1665
   00650 Butanoate metabolism
    NT01EI_1665
  Lipid metabolism
   00071 Fatty acid degradation
    NT01EI_1665
  Amino acid metabolism
   00350 Tyrosine metabolism
    NT01EI_1665
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NT01EI_1665
   00626 Naphthalene degradation
    NT01EI_1665
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NT01EI_1665
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NT01EI_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ACR68846
UniProt: C5BD94
Position
complement(1623491..1626163)
Genome map
AA seq 890 aa AA seqDB search
MAVTNTAELDTLVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPTGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKQATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDKVRERFATHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
AEKIAEMAGISVPAGTKILIGEVSIVDDSEPFAHEKLSPTLAMYRAKNFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQGVRVNYFGEKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGALPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTNVLKAHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIGRLLAWLESIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGREFVEHAQEESKAVVTPKAEKKAKKA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaacaccgctgaactcgatacgctggtcgcccgtgtaaaaaaagcccaa
cgcgagtttgccaacttctctcaggaacaggtagacaaaatcttccgtgccgccgctctg
gccgccgccgatgcccgtattccgctggctaaaatggccgtcgctgaatccggtatgggt
atcgttgaagataaagtgataaaaaaccacttcgcttccgaatatatctacaacgcctat
aaagatgaaaaaacctgcggtattctgtccgaagacgataccttcggcacgattaccatc
gctgagccaaccggtctgatctgcggtatcgtaccgaccaccaacccgacctccaccgca
atcttcaaggcactgatcagcctgaagacccgtaacggcatcattttctccccgcatccg
cgtgccaaacaggccactaacaaggccgccgatatcgtgctgcaggcagccatcgccgcc
ggcgcgccgaaagacatcatcggttggatcgatgagccatccgtcgagttgtccaacgcg
ctgatgcaccatccagacatcaacctgatcctggccaccggtggcccaggcatggttaaa
gcagcctatagctccggcaagccagctatcggcgttggtgcaggcaacacgccggtggtg
atcgacgaaaccgcagatatcaaacgcgcagtcgcctccatcctgatgtccaagaccttc
gacaatggcgtaatctgtgcatctgaacagtctgttatcgtcgtcgactccgtctacgac
aaagtgcgtgagcgttttgctacccacggcggctacctgctgcagggtaaagaactgaaa
gccgttcaggatatcatcctgaagaatggcggactgaatgccgccattgtaggccagccg
gcagagaaaatcgctgaaatggcaggaatcagcgtaccggcagggaccaagattctgatc
ggcgaagtcagcattgttgacgactccgagccattcgcacacgagaaactgtctccaacc
ctggccatgtaccgtgccaagaacttcgaagacgccgtagagaaagccgagaagctggtt
gccatgggtggtatcggtcatacctcctgcctgtacaccgaccaggataaccagggcgtg
cgcgtaaactacttcggcgagaagatgaagaccgcccgcatcctgatcaataccccagcc
tctcaggggggcatcggtgacctgtacaacttcaaactggcgccctccctgacgctgggc
tgcggctcctggggtggtaactccatctctgagaacgtgggtccaaagcacctgatcaac
aagaaaacggtagcgaagcgagcagaaaacatgttgtggcataaacttcctaagtctatc
tacttccgccgcggcgccctaccgatcgcgctggaagaagtggcaaccgacggtgccaag
cgcgcctttatcgtcaccgaccgtttcctgttcaacaacggttatgccgaccaggttacc
aacgtactgaaagcgcatggcatcgaaaccgaagtcttcttcgaagttgaggccgatccg
accctgagcatcgtgcgcaaaggcgccgagcagatgaactccttcaaaccggacgtgatc
atcgcgctgggcggcggctcgccgatggatgcggccaagatcatgtgggttatgtacgag
cacccggagacccatttcgaggagctggcactgcgctttatggatatccgtaagcgtatc
tataaattcccgaaaatgggtgttaaagccaagatgatcgccatcaccaccacctctggt
accggctctgaagttacgccgttcgccgtggtgaccgacgatgcgaccgggcagaaatac
ccgctggctgactatgcgctgacgccggacatggccatcgtagatgccaatctggtgatg
aacatgccgaaatccctgtgcgccttcggcggtctggatgcggtaacccatgcgctggaa
gcctatgtttccgttctggccaatgaatactctgacggccaggcgctgcaggccctgaaa
ctgctgaaagagttcctgcctgccagctacgcagagggtgccaaaaacccggttgcccgc
gagcgtgtacacaacgccgcaaccatcgccggtatcgcctttgccaatgccttcctcggg
gtatgtcactccatggcccacaaactgggttccgagttccacattccgcacggtctggcc
aacgccctgctgatctctaacgttatccgctacaacgctaatgacaacccgaccaagcag
accgcattcagccagtacgaccgtccgcaggcccgtcgccgctacgctgagatcgcagac
catctgggtctgagcgcaccgggcgaccgcaccgcgcagaagatcgggagactgctggcc
tggctggagagcatcaaggctgaactgggtatccccgcctctatccgtgaagccggcgta
caggaagccgacttcctggcgaaagtggataagctgtccgaagatgccttcgatgatcag
tgcaccggtgccaacccgcgctatccgctgattgccgaactcaaacaaattctgctggat
acctactacggccgcgagtttgttgagcacgcgcaggaggagagcaaggccgtcgtcact
ccgaaagcggaaaaaaaagccaaaaaagcctga

DBGET integrated database retrieval system