KEGG   Edwardsiella ictaluri: NT01EI_1687Help
Entry
NT01EI_1687       CDS       T00912                                 

Definition
(GenBank) tryptophan synthase, alpha subunit, putative
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01EI_1687
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01EI_1687
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT01EI_1687
Enzymes [BR:eic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT01EI_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1647243..1648049)
Genome map
AA seq 268 aa AA seqDB search
MTRYQTLFTHLQRRQEGALVPFVTLGDPTPSLSLQIIDALVESGADALELGIPFSDPLAD
GPVIQSATLRALQAGVTPERCFTLLATLREKYPQLPIGLLMYANLVVNPGIDTFYRRCAQ
AGIDSVLIADVPLEESAPFHAAAQRYGVAPIYLCPPNADDVLLQQLAARSQGYVYLLSRA
GVTGSDRPCLPPLRHLTTRLAALGAAPTLQGFGIQTPDQVRSALDGGAAGAISGSAVVDL
IARHLDTPPQMLQQLRAFIQTMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacacgctaccagacgctatttacccatctacagcgccgccaggaaggcgcgctggtc
cccttcgtcacactgggcgaccctacgccgtcgctgtcgctgcaaattatcgacgcgctg
gtggagtccggcgccgatgcgctggagctggggatccccttctccgacccgctggccgac
ggcccggtgatccagagtgcgactctgcgcgccctgcaggcgggcgtcacccccgagcgt
tgctttacgctgctggctaccctgcgggaaaaatatccccagttgcccattggactgctg
atgtacgctaacctggtggttaatccagggatcgacaccttttaccggcgctgtgcccag
gccggcattgactcggtcttgattgccgatgtcccgctggaggagtccgcccccttccac
gcggcggcgcagcggtacggggtcgcgccgatctacctgtgtccgcccaacgccgatgat
gtactgctgcagcaactggccgcgcgcagtcaggggtacgtttacctgctgtcacgcgcc
ggggtcaccggcagcgatcgcccctgcctgccgccactgcgccatctcacgacgcggctg
gcagcgctgggtgccgcgccgacgctacagggattcgggattcagacacccgatcaggta
cgcagcgcgctggacggtggcgccgcgggcgccatttccggctcggcagtggtcgacctg
atcgctcgccatctggataccccgccccagatgctgcagcagctgcgcgcgttcatccaa
accatgaaggccgcaacccgcgcctga

DBGET integrated database retrieval system