KEGG   Edwardsiella ictaluri: NT01EI_1688Help
Entry
NT01EI_1688       CDS       T00912                                 

Definition
(GenBank) tryptophan synthase, beta subunit, putative
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00260  Glycine, serine and threonine metabolism
eic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01130  Biosynthesis of antibiotics
eic01230  Biosynthesis of amino acids
Module
eic_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01EI_1688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT01EI_1688
Enzymes [BR:eic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT01EI_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACR68869
UniProt: C5BDB7
Position
complement(1648046..1649239)
Genome map
AA seq 397 aa AA seqDB search
MSLLNPYFGEFGGRFVPQILIPALNQLEAAFVDARDDPTFQTQFNDLLHNYAGRPTALTL
CRNLTAGTRTRLYLKREDLLHGGAHKTNQVLGQALLARRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVARQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSANY
DQAHYLLGTAAGPHPYPTIVREFQRMIGAETRRQILQAEGRLPDAVLACVGGGSNAIGMF
ADFIDDASVQLIGVEPAGLGIETGQHGAPLSHGRVGIYFGMRSPMMQTAEGQIEESYSLS
AGLDFPSVGPQHAHLNSIGRADYVSATDDEALAAFMQLSRQEGIIPALESAHALAHALKL
IHQQPEKEQLLVVNLSGRGDKDIFTVHDILQSRGEIQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcttactgaatccctatttcggcgaatttggcggcaggtttgtgccgcaaattctg
atcccggccctgaaccagctggaggccgccttcgtcgacgcccgcgacgatcccaccttt
cagacccagttcaatgacctgctgcacaactatgccgggcgaccgacggcgttgaccctc
tgccgcaatctcaccgccggtacccgcacccgcctgtacctaaagcgtgaggatctgctg
cacggcggcgcgcacaaaaccaatcaggtacttggccaggcgctgctggccaggcgcatg
ggtaagaccgagatcatcgcggaaaccggcgcgggtcagcacggcgtcgcaacggcgctg
gcctgtgccttgctgggtctgaaatgccgggtctacatgggggccaaagacgttgcccgc
cagtctcccaatgtgttccgtatgcggctgatgggcgccgaggtgatcccggtgcacagc
ggctcggccaccctaaaagatgcctgcaatgaggcgctgcgcgactggtccgccaactat
gaccaggcccactatctgttgggcaccgccgccggcccccatccctatccgaccatcgtg
cgcgaatttcagcggatgatcggcgcggagacgcgccgtcagatcctgcaggccgaaggc
cgcctgcccgatgcggtattggcctgcgtcggcggcggctccaacgccatcgggatgttc
gccgactttatcgatgatgcgtcggttcagcttatcggcgtcgaaccggctgggctgggc
attgagaccgggcagcacggcgcgccgctcagtcacggccgcgttggcatttacttcggc
atgcgctctcccatgatgcagaccgccgaggggcagattgaggagtcctactccctttcc
gccgggctggattttccctcggtaggcccccagcacgcccacctgaacagcattggccgg
gccgactatgtctccgcgaccgacgacgaagcgttggccgcctttatgcagctctcgcgc
caggagggcattattccggcgttagagtccgcccatgcgttggcccacgccctgaagctc
attcatcagcagccagaaaaagagcagctgctggtggtgaatctttccgggcgcggtgac
aaggatatttttaccgttcacgacattctgcagtcccggggagaaatacaatga

DBGET integrated database retrieval system