KEGG   Edwardsiella ictaluri: NT01EI_1777Help
Entry
NT01EI_1777       CDS       T00912                                 

Definition
alpha-galactosidase, putative (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
eic  Edwardsiella ictaluri
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NT01EI_1777
  Lipid metabolism
   00561 Glycerolipid metabolism
    NT01EI_1777
   00600 Sphingolipid metabolism
    NT01EI_1777
Enzymes [BR:eic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     NT01EI_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1721877..1723229
Genome map
AA seq 450 aa AA seqDB search
MNAPKIAFIGAGSTIFVKNILGDVFQRPALRGADIALMDIDAQRLAESRIVVGRLMAAAG
ADGHIQCHTTLRPALQGADFVVVAFQIGGYTPCTVTDFEVCARHGLRQTIGDTLGPAGIM
RALRTFPHLWQIGEMMMAECPQATLLNYVNPMAMNSWAMYARYPQLRQVGLCHSVQGTAE
ELARDLDIDPAQLRYRCAGINHMAFYLSLEQRGGDGQYRDLYPQLLQAYRQGRAPKPNIH
GNLRCENIVRYELLQKLGYFVTESSEHMAEYTPWFIKPGRDDLIARYRIPLDEYPKRCVE
QMASWQRELAEYQAAPHIEITPSREYASRIMNALWSGEPEVIYGNVRNAGLIDNLPQGCC
VEVPCLVDANGIQPTRIGSLPSHLAALMQTNVNVQTLVTEAALTENRERIYHAALLDPHT
AATLSIDEIYALIDDLIAAHGDWLPDWVRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctaaaattgcctttattggcgcaggttcaaccatttttgtgaagaatatt
ctgggggatgtattccagcgccccgcgctgcggggagccgatatcgcgttgatggatatc
gatgcgcagcgcctggccgagtcgcggatcgtcgttggccggctgatggcggcggccgga
gctgacggacacattcagtgccatacgacgttgcgtccggcgctgcagggggccgatttt
gtggtggtggcgtttcagatcggtggctatacgccctgcacggtcaccgattttgaggtc
tgtgcacgccatggcctgcggcagaccatcggcgacaccctggggccggccggcattatg
cgtgcgctgcgtacctttccacacctgtggcagataggcgagatgatgatggcggagtgt
cctcaggcgacgctgctaaactatgtcaatccgatggcgatgaatagctgggctatgtat
gcgcgctatccgcagctgcggcaggtcggtctatgccactcggtacagggcacggcggag
gagctggcgcgggatctcgatatcgatccggcgcagctacgctaccgctgcgccgggatt
aaccatatggccttctatctttcgctggagcagcgcggcggggacggtcagtatcgcgat
ctctacccgcagctgctgcaggcctatcgtcaggggcgggcgccgaagccgaacatacat
ggcaacctgcgctgcgagaatatcgtacgctatgagctgctgcaaaaactgggttacttt
gtcacggagtcctcagagcatatggccgaatatacgccgtggtttatcaagcctgggcgc
gatgatctgatcgcgcgttaccgcatcccgctggatgagtatcccaaacgctgcgtggag
cagatggcgagctggcagcgcgagctggcagagtatcaggcggcgccgcatatcgagatt
acgccatcgcgggagtacgccagccggatcatgaatgcgctgtggagtggggagccagag
gtgatctatggcaacgtgcgtaacgcgggcctgatcgacaacctgccacagggttgctgt
gtggaagttccctgtctggtcgatgccaatgggatccagccgacgcggatcgggtcgctg
ccctcgcacctggcggcgctgatgcagaccaatgtcaatgtgcagacgctggtaacggag
gcagcgctgacggaaaaccgcgagcggatataccatgccgcactgctcgatccgcatacg
gctgcgacgctgagtatcgatgagatctatgccctgatcgacgatctcattgcggcgcac
ggtgactggctgcctgactgggtgcgcggctga

DBGET integrated database retrieval system