KEGG   Edwardsiella ictaluri: NT01EI_1812Help
Entry
NT01EI_1812       CDS       T00912                                 

Definition
glycosyl hydrolase family 3 protein (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eic  Edwardsiella ictaluri
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NT01EI_1812
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NT01EI_1812
Enzymes [BR:eic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NT01EI_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1748809..1749831
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVVGHELDAEEREILDHPLVGGVILFSRNFDDPAQLRELVRQIRQAARHPLLVT
VDQEGGRVQRFHQGFTRLPAAQSYAALNTPQEAQRLALEGGWLMACEMIAMDIDLSFAPV
LDLGHGSAAIGERAFHREAESAIPLAQAFIDGMHQAGMKATGKHFPGHGKVSADSHKETP
IDARPLVQIVEHDMVIFRTLNACGKLDAVMPAHVIYSQADSRPASGSPYWLQQVLRQTLG
FEGVVFSDDLSMNGAAVMGSYAQRAQASLDAGCDMVLVCNNRQGAISVLDHLSAAGSPRI
ARLRHRGQVDREGLMGSARWKQAHQDLQRLHQRWEEAKQA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggtcctgtaatgctggatgttgtcggccatgagctggatgccgaggagcgtgagatc
ctggatcatccgttggtcggtggcgtgatcctgtttagccgtaattttgacgatccggca
cagctgcgtgagctggtgcgccaaatccgccaggcggcacgccaccctttactggtgacc
gtcgatcaggaggggggacgggtgcagcgcttccatcaggggtttacccgcctgccggca
gcgcagtcctatgccgcgctcaacacgccgcaggaggcgcagcgtctggcgttggagggc
ggctggctgatggcctgcgagatgatcgccatggatatcgatctgagttttgccccggtg
ctggatttggggcacggcagtgccgccatcggcgaacgtgcgttccaccgggaggcagag
agcgccattccgctggcgcaggcgtttatcgacgggatgcaccaggcgggaatgaaggcg
accggcaagcattttccggggcatggcaaggtgagtgcggactcccataaagagacgccg
atcgacgcgcgtccgctggtgcaaatcgttgagcatgatatggttattttcaggacgctg
aatgcgtgcggcaagctggatgcggtcatgcctgcccacgtgatctattcacaggcggat
tcccgcccggccagcggctcaccctactggctgcagcaggtactgcgccagaccctgggc
ttcgagggggtggtcttctcggacgatctatcgatgaacggcgccgcggtgatgggcagc
tatgcgcagcgggcgcaagcgtctctggatgccggctgcgatatggtgctggtatgcaat
aaccgccagggtgctatcagcgtgctggaccacctgtctgctgcggggtcaccgcgtatt
gcccgcctgcgtcaccgtggtcaggttgatcgcgaggggctgatgggcagcgcgcgctgg
aagcaggcgcatcaggatttgcaacgcttacaccagcgttgggaggaggccaaacaggcc
tga

DBGET integrated database retrieval system