KEGG   Edwardsiella ictaluri: NT01EI_1878Help
Entry
NT01EI_1878       CDS       T00912                                 

Definition
phosphofructokinase 2, putative (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_1878
   01230 Biosynthesis of amino acids
    NT01EI_1878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_1878
   00030 Pentose phosphate pathway
    NT01EI_1878
   00051 Fructose and mannose metabolism
    NT01EI_1878
   00052 Galactose metabolism
    NT01EI_1878
  Energy metabolism
   00680 Methane metabolism
    NT01EI_1878
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NT01EI_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1810972..1811925
Genome map
AA seq 317 aa AA seqDB search
MNSVYTLTLSPSLDCSTSTDKIYPEGKLRCSQAIYQPGGGGVNVARAIYRMGGGAVAIYP
AGGSTGAYLTTLLLAEGIAVDVVEVQSWTRQNMHINVTATGEQFRFVMPGADLTPREFDL
LTQRLDQIPADAFLVVSGSLPESITPQRFAALLQYVCQRGIRCVVDTSGDALMTAVSQGG
LALIKPNQKELATLSGRDMTQPASVLQAAHALVLQGVAQYVVVSLGAQGAIAVDRQAWIQ
VTPPPIKALTTVGAGDSMVAAMTLQLALGGSLSTLAIGGVAAGTAATLRHGTELCQASDV
AEIAAYIEAHHPQSHPF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaattctgtctatacccttacgctgtctccctcgctggactgttcgaccagcacggat
aaaatatatccggagggtaagttacgctgcagtcaggccatataccaaccgggtggcggt
ggggttaacgtggccagggccatttaccgcatggggggaggcgcagtggccatctatcct
gcgggaggatcgaccggtgcatacttaaccacactgctgttggcggaagggattgcggtt
gatgtggtagaggtacagagctggacgcgtcaaaatatgcatatcaatgtgacggctacc
ggcgagcagtttcgttttgtgatgcctggcgcggatctgacgccgcgggaattcgatctt
ctgacgcaacgacttgatcagatccccgcggatgcttttttggtggtgagcggaagtttg
ccggaaagcattacgccgcagcggtttgccgcactgctgcagtacgtttgtcagcgtggt
attcgctgcgttgtcgatacctcgggcgatgccttgatgacggcggtgagtcagggagga
ctggcgctgattaaacctaatcaaaaggagctggcgacgttgagcgggcgggatatgacg
cagccggcttcggttttgcaggcggcccatgcgctggtattgcagggcgttgcgcagtat
gtggtggtttccctgggggctcagggggcgattgccgttgatcgtcaagcctggattcag
gtgacgccgccgccgattaaggcgctgacgacggtgggagccggtgacagtatggtcgcc
gcgatgacgctgcagctggctctgggaggatcgctgagcacactggcgattggcggtgtt
gcggccggaaccgcggcaacgctacgccacggtaccgagctatgtcaggcgagcgatgtc
gcggagattgcagcctatattgaggcccatcacccgcagtcgcatccattctaa

DBGET integrated database retrieval system