KEGG   Edwardsiella ictaluri: NT01EI_1953Help
Entry
NT01EI_1953       CDS       T00912                                 

Definition
oxidoreductase, short chain dehydrogenase/reductase family
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
eic  Edwardsiella ictaluri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT01EI_1953
   00670 One carbon pool by folate
    NT01EI_1953
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NT01EI_1953
    1.5.1.-  
     NT01EI_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1882962..1883573)
Genome map
AA seq 203 aa AA seqDB search
MDTLSMPPVVITGGARRVGLALALSLLARELPVLVAYRSEYPALASLRQAGARCLRCDFS
TTEGIYDFAAQVQRITPHLRALIHNASAWQAERPDVAPEQTLNAMLQIHVHTPYLLNLLL
EPLLRGQGDAGADIIHVTDYVVERGSDSHIAYAAGKAALDNMTRSFARKLAPEVKVNAIA
PALILFNPQDDEAYRQKALDKSR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggatacgctgtccatgccgccggtggtgatcaccggcggcgcccgtcgcgttggactg
gcgctggccctctccctgcttgccagagagctccccgtactggtggcctatcgcagtgaa
taccctgccctggcatcgctgcgtcaggccggggctcgctgcctacggtgtgatttttct
acgacagaggggatctatgatttcgccgcgcaggtgcagcggatcacgcctcacctgcgg
gcactgatacacaacgccagcgcctggcaggccgagcgtcccgatgttgcaccggagcag
acactcaatgccatgttacagatccacgttcatacgccctacctgttgaatctgttgctg
gagcctctgttgcgtggacagggagacgcaggcgccgatatcatccatgtgaccgattat
gtcgtagagcgtggcagcgacagccatatcgcctatgcagctggtaaggctgcgctggac
aatatgacgcgctcctttgcccgtaagctggctcctgaggtcaaggttaacgccatcgct
ccggcactgatcctgttcaacccgcaggatgatgaggcctatcggcaaaaagcactggat
aagagccgctaa

DBGET integrated database retrieval system