KEGG   Edwardsiella ictaluri: NT01EI_2069Help
Entry
NT01EI_2069       CDS       T00912                                 

Definition
cytochrome-c peroxidase, putative (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
eic  Edwardsiella ictaluri
Brite
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NT01EI_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1988805..1990274
Genome map
AA seq 489 aa AA seqDB search
MKKITKWAGGIVITGIVCYLGLVGYVYNHDKQRNTVPSEPASSALNAQVLGILGEKGCDY
CHTPSSNLPFYASVPGVKQLMEYDMYQGYKAFNLIPLRESLLKPSPRKASSGQPPTLTDL
NKLEWVIQHQTMPPTRYTAMHWAGRMSQADRDTLLQWVGEQRQKYYSTPDMAPSLRNEPI
QPIPESLPVSAEKVALGFRLYHDPRLSSNNTVACAHCHQLGAGGVDGRKTSLGVDDQVGP
INAPTVFNAVFNIAQFWDGRAATLQDQAGGPPLNPIEMASTSWEQIIDKLNQDQAFKQDF
LKVYPQGFSGKNITDAIAEFEKTLITPNSAFDRYLRGDSNALTAQQQRGYQLFKDNRCAT
CHAGVAMGGESYEPLGLIKAYPFGELTNADIGRMNVTHELRDKLRQKVPTLRNVELTGPY
FHRGDVKTLDEAVKQMLRYQVGVTLPQSDVNDIVAFLKSLTGVYTPYPMNTAPAVETPAA
PKKVEAAHP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataacgaaatgggcaggcggtatcgtcattaccggtatcgtctgctactta
gggttggtcggctatgtctataatcatgacaaacaacgtaataccgtaccgagtgaaccg
gcaagttcagcacttaacgctcaggtattagggatcttgggcgaaaaaggctgtgactac
tgtcatactccatcgagcaatttaccgttttacgccagcgttcccggcgtgaagcagctg
atggaatatgatatgtatcagggatataaggcgttcaatctgatacctctgcgcgaaagc
ctgctgaaaccctccccgaggaaagcctccagcggccaaccgccgaccctgacggatctc
aataagttggagtgggtgattcagcatcagaccatgccgccaacccgttataccgcaatg
cactgggccggccgaatgtcgcaggccgatcgcgatacgctgctacagtgggtgggtgag
cagcgtcaaaaatactattcgacaccggatatggcgccatcgctacgcaatgagccgata
cagccgatccccgagtccttaccggtcagtgccgaaaaagtcgcgctgggattccgtctg
taccacgatccgcgtttatccagcaataacaccgtggcctgtgcccattgtcaccaattg
ggcgctggtggcgtagatggaagaaaaacatcgctgggcgtcgatgaccaggtgggcccc
attaacgccccaacggtgtttaatgctgtgttcaatattgctcaattctgggatgggcgt
gcggcaaccctgcaggatcaggcgggtggtcctccgctgaacccgatcgagatggcatct
acatcgtgggagcaaatcatcgataagctgaatcaagatcaggcatttaagcaggatttc
ctcaaggtgtacccgcagggattcagtggaaaaaatatcaccgatgccatcgccgagttt
gaaaaaacgctgattacgccgaactccgcgtttgaccgctatctgcgcggcgatagcaac
gcgctcactgcccagcagcagcgcggctatcagctgtttaaggataatcgctgcgcaacc
tgtcacgctggcgttgcaatgggcggagagtcttatgaacctctcggactgatcaaggca
tatccgtttggcgaactgaccaacgctgatatcggtagaatgaacgtgactcatgaactg
cgcgataaactgcgccagaaggtgccgacgctgcgtaacgttgagctgaccggtccctac
ttccaccgtggtgatgtgaagacactggatgaggcggtgaagcaaatgctgcgctatcag
gttggcgtcaccctgccgcaaagcgatgtcaacgatatcgtagccttcctgaagagcctg
accggtgtctatacgccctatccgatgaatacggcacccgccgtagagaccccggcagca
ccgaagaaggtggaggcggcccatccatag

DBGET integrated database retrieval system