KEGG   Edwardsiella ictaluri: NT01EI_2128Help
Entry
NT01EI_2128       CDS       T00912                                 

Definition
myo-inositol catabolism protein IolB, putative
Orthology
K03337  
5-deoxy-glucuronate isomerase [EC:5.3.1.30]
Organism
eic  Edwardsiella ictaluri
Pathway
Inositol phosphate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NT01EI_2128
Enzymes [BR:eic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.30  5-deoxy-glucuronate isomerase
     NT01EI_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2054909..2055724)
Genome map
AA seq 271 aa AA seqDB search
MSRLLSRWQPPDAQGCTQSITPERAGWGHVGFAVFELEAGRQLTLPAVSEERCLVLVAGR
ASITAPTARFANIGERMSPFERKKPWAVYVAPGETVQVQAETRLELAVCAAPSQGTWPTR
LIAPQDIDAEARGKGNNRRYVHNILPQDKPADSLLVVEVWTDEGCTSSYPSHKHDTDNPP
QETCLEETYYHRLNPEQGFCMQRVYTDDRALDECMAVYNRDVVMVPQGYHPVATMAGYDS
YYLNVMAGPVRRWMFTWEACHGWINQDYPRK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtttactttcgcgctggcagccgccggacgcacaagggtgcacccaatccatt
acgccagagcgtgcgggctggggccatgttggctttgcggtgtttgaactggaggcgggg
cggcagttaacgctgcctgcagtcagtgaagagcgctgcctggtgctggtggccggtcgg
gcctccatcactgcaccgaccgcgcggttcgccaatatcggcgagcggatgagcccgttc
gagcggaaaaaaccgtgggcggtatacgtcgcgcccggcgaaaccgtgcaggtacaggcc
gagacccggcttgagctggcggtgtgcgccgcgcccagccaaggtacctggccgacccgg
ctgatcgcgccgcaggatatcgatgccgaagcccgcggcaagggaaacaaccggcgctat
gtgcacaacattctgccgcaggataaacccgcggacagcctgctggtggtggaggtatgg
actgacgaaggctgtaccagttcctatcccagccataagcatgataccgacaacccaccg
caggaaacctgccttgaggagacctattaccaccgcctcaatccggagcagggattctgt
atgcagcgggtatataccgacgatcgggcgcttgatgagtgcatggcggtgtacaaccgc
gacgtggtgatggtgccgcaggggtatcacccggtggcgacgatggcgggctacgacagc
tattacctcaacgtcatggccggtccggtacggcgctggatgttcacctgggaggcgtgt
catggctggattaatcaggattatccgcgcaagtaa

DBGET integrated database retrieval system