KEGG   Edwardsiella ictaluri: NT01EI_2565Help
Entry
NT01EI_2565       CDS       T00912                                 

Definition
histidinol dehydrogenase, putative (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eic  Edwardsiella ictaluri
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01EI_2565
  Amino acid metabolism
   00340 Histidine metabolism
    NT01EI_2565
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NT01EI_2565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2457105..2458415
Genome map
AA seq 436 aa AA seqDB search
MIRFDTLIQWDDCSPEQQHCLLQRPAIASAAQISANVEAIIAQVRHDGDAALHRLSQRFD
REAPAILRVSRQIRDVAGDSLPDALTRAMGQAAKNIEVFHRAQCPAPVEVETQPGVCCRQ
ISRALDTVGLYIPGGSAPLLSTVLMLGIPARVAQCRRVILCSPPPIDPAILYAARLCGID
EIFQVGGAQAIAAMAFGTESVPRVDKIFGPGNAYVTEAKRQVSQSPRGAAIDMPAGPSEV
LVIADSGANPEFIAADLLSQAEHGPDSQVLLLTPDAPLARRVAERVKAQLALLPRADIAR
QALAQSRLIVTRSLAQCIEISNRYGPEHLIIQTRDAEAWLDAITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTATHSSLGLADFQKRMTVQRLSPAGLLTLAPTVEAMAQAECLDAH
ANAVRLRVAAIRESQS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctttgatacgcttatccaatgggacgactgtagccccgaacagcagcactgc
ctgctacagcgcccggcgatcgccagcgccgcgcaaatcagtgcaaacgttgaggcgatc
atcgcccaggttcgccacgacggtgatgcggcgctgcatcgcctcagccaacgctttgac
cgggaggcacctgccatcctgcgcgtttcacgtcagatccgcgacgtcgccggcgacagt
ctgcccgacgcactgacccgcgccatgggccaggcggccaagaatattgaggtctttcat
cgcgcccagtgcccggcccctgtcgaggtcgaaacccagcccggcgtctgctgccgccag
atctcccgcgcactggacaccgtcggcctgtatattcccggcggcagcgccccgttgctc
tccacggtgctgatgctggggatcccggcccgcgtggcgcagtgccgtagagtgatcctc
tgctcaccaccgccgattgacccggcgatcctctacgccgcacgcctgtgcggcatcgac
gaaatttttcaggtcggcggcgcgcaagcaatcgccgccatggccttcggaaccgaatcc
gtcccccgcgtcgacaaaatctttggccccggaaacgcctatgtcaccgaggccaaacgg
caggtcagccaaagccctcggggcgccgccatcgatatgcccgccggcccctccgaggtg
ctggtgatcgccgattccggagccaacccggagtttatcgccgccgatctgctctcccag
gcggagcatggccccgactcacaggtgctcctgctgacgcccgatgccccgctggcccgc
cgggtcgccgaacgggtcaaggcgcagcttgccctcctgccacgcgctgacatcgcccgc
caggcgctggcgcagagccgcctgatcgtcacccgttcgctggcgcagtgcatcgagatc
agcaaccgctatgggccggagcacctcatcattcaaacccgcgacgccgaggcgtggctc
gatgccatcaccagcgctggctccgtgtttctgggcgactggtcgcccgaatccgcgggg
gactatgcctccggcaccaatcacgtgctgccgacctacggctacaccgccacccactcc
agtctggggctggcagatttccagaaacgcatgaccgtccaacgcctcagccccgcaggc
ctgctgacgctggccccgacggtcgaggccatggcgcaggctgagtgccttgacgcccac
gccaacgccgtccgcctgcgggtcgccgccatccgggagagccaatcatga

DBGET integrated database retrieval system