KEGG   Edwardsiella ictaluri: NT01EI_2565Help
Entry
NT01EI_2565       CDS       T00912                                 

Definition
histidinol dehydrogenase, putative (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eic  Edwardsiella ictaluri
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eic01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:eic00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2457105..2458415
Genome map
AA seq 436 aa AA seqDB search
MIRFDTLIQWDDCSPEQQHCLLQRPAIASAAQISANVEAIIAQVRHDGDAALHRLSQRFD
REAPAILRVSRQIRDVAGDSLPDALTRAMGQAAKNIEVFHRAQCPAPVEVETQPGVCCRQ
ISRALDTVGLYIPGGSAPLLSTVLMLGIPARVAQCRRVILCSPPPIDPAILYAARLCGID
EIFQVGGAQAIAAMAFGTESVPRVDKIFGPGNAYVTEAKRQVSQSPRGAAIDMPAGPSEV
LVIADSGANPEFIAADLLSQAEHGPDSQVLLLTPDAPLARRVAERVKAQLALLPRADIAR
QALAQSRLIVTRSLAQCIEISNRYGPEHLIIQTRDAEAWLDAITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTATHSSLGLADFQKRMTVQRLSPAGLLTLAPTVEAMAQAECLDAH
ANAVRLRVAAIRESQS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctttgatacgcttatccaatgggacgactgtagccccgaacagcagcactgc
ctgctacagcgcccggcgatcgccagcgccgcgcaaatcagtgcaaacgttgaggcgatc
atcgcccaggttcgccacgacggtgatgcggcgctgcatcgcctcagccaacgctttgac
cgggaggcacctgccatcctgcgcgtttcacgtcagatccgcgacgtcgccggcgacagt
ctgcccgacgcactgacccgcgccatgggccaggcggccaagaatattgaggtctttcat
cgcgcccagtgcccggcccctgtcgaggtcgaaacccagcccggcgtctgctgccgccag
atctcccgcgcactggacaccgtcggcctgtatattcccggcggcagcgccccgttgctc
tccacggtgctgatgctggggatcccggcccgcgtggcgcagtgccgtagagtgatcctc
tgctcaccaccgccgattgacccggcgatcctctacgccgcacgcctgtgcggcatcgac
gaaatttttcaggtcggcggcgcgcaagcaatcgccgccatggccttcggaaccgaatcc
gtcccccgcgtcgacaaaatctttggccccggaaacgcctatgtcaccgaggccaaacgg
caggtcagccaaagccctcggggcgccgccatcgatatgcccgccggcccctccgaggtg
ctggtgatcgccgattccggagccaacccggagtttatcgccgccgatctgctctcccag
gcggagcatggccccgactcacaggtgctcctgctgacgcccgatgccccgctggcccgc
cgggtcgccgaacgggtcaaggcgcagcttgccctcctgccacgcgctgacatcgcccgc
caggcgctggcgcagagccgcctgatcgtcacccgttcgctggcgcagtgcatcgagatc
agcaaccgctatgggccggagcacctcatcattcaaacccgcgacgccgaggcgtggctc
gatgccatcaccagcgctggctccgtgtttctgggcgactggtcgcccgaatccgcgggg
gactatgcctccggcaccaatcacgtgctgccgacctacggctacaccgccacccactcc
agtctggggctggcagatttccagaaacgcatgaccgtccaacgcctcagccccgcaggc
ctgctgacgctggccccgacggtcgaggccatggcgcaggctgagtgccttgacgcccac
gccaacgccgtccgcctgcgggtcgccgccatccgggagagccaatcatga

DBGET integrated database retrieval system