KEGG   Edwardsiella ictaluri: NT01EI_2687Help
Entry
NT01EI_2687       CDS       T00912                                 

Definition
aminotransferase, putative
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eic  Edwardsiella ictaluri
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    NT01EI_2687
   01230 Biosynthesis of amino acids
    NT01EI_2687
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NT01EI_2687
   00290 Valine, leucine and isoleucine biosynthesis
    NT01EI_2687
Enzymes [BR:eic01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NT01EI_2687
    2.6.1.66  valine---pyruvate transaminase
     NT01EI_2687
Amino acid related enzymes [BR:eic01007]
 Aminotransferase (transaminase)
  Class I
   NT01EI_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2582233..2583453
Genome map
AA seq 406 aa AA seqDB search
MSPIEKSHKLDHVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYSDSKGLYSARKAIMQHYQAHDIRDVSVEDIYIGNGVSELIVQSMQALLNTND
EMLVPAPDYPLWTAAVALSGGNAVHYRCDEQADWFPDIDDIRSKITPRTRGIVIINPNNP
TGAVYSKALLEQIVDLAREHNLIIFADEIYDKILYDDAQHISIATLAPDLLVITFNGLSK
TYRVAGFRQGWMVLSGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
CPGGRLYEQRNRAWELINQIPGLSCVKPRGALYMFPKIDAKRFNIHNDQKMVLDLLLQEK
VLLVQGTAFNWPEPDHFRIVTLPHVDELDSAILKLGRFLSTYHQKY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgatcgaaaaatcccacaagctggaccacgtatgctacgacatccgcggcccg
gtgctcaaagaagccaagcggctggaagaagaaggcaataaagtcctcaagctgaacatt
ggcaacccggcccccttcggctttgaagcgcctgacgaaattctggtcgacgtgatccgt
aacctaccgacggcgcagggctacagcgactccaaaggactctattcggcgcgcaaggcc
attatgcagcactaccaggcccacgacatccgcgacgtcagcgtcgaggacatctacatc
ggcaacggcgtctccgagcttatcgtgcagtccatgcaggcactgctcaacaccaatgac
gaaatgctggttccggccccagactacccgctgtggaccgctgccgttgcgctctccggc
ggcaacgcggttcactaccgctgcgatgagcaggcggactggttccccgacattgacgat
atccgtagcaaaatcaccccgcgcacccgcggcatcgtcatcatcaaccccaataatccg
accggtgctgtctacagcaaggcgctgttggagcagattgtggatctggcccgcgaacat
aacctgatcatctttgccgatgagatctacgacaagatcctgtatgacgatgcgcagcat
atatccattgccacgctggcgccggatctgctggtgatcacctttaacggcctctccaaa
acctaccgcgtggccggtttccgtcagggctggatggtgctcagcgggccgaaaaagcac
gccaaaggctacattgaggggctggagatgctggcctccatgcgcctgtgcgccaacgtg
ccgatgcagcatgccattcagactgcgctgggcggatatcagagcatcagcgagtttatc
tgcccgggtggtcggctgtatgaacagcgtaaccgcgcctgggagctgatcaaccaaatt
ccggggctctcctgcgtcaagccgcgcggggcgctgtatatgttcccaaagatcgacgcc
aaacgctttaatattcacaacgatcagaagatggtgctggatctgctactgcaggaaaaa
gtcctgctggtgcaggggaccgccttcaactggccggagccggatcacttccgcatcgtc
acccttccgcatgttgacgagctggacagtgccatcctcaagctggggcgcttcctatcg
acctatcaccagaaatattga

DBGET integrated database retrieval system