KEGG   Edwardsiella ictaluri: NT01EI_2846Help
Entry
NT01EI_2846       CDS       T00912                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_2846
   01230 Biosynthesis of amino acids
    NT01EI_2846
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_2846
  Energy metabolism
   00680 Methane metabolism
    NT01EI_2846
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01EI_2846
Enzymes [BR:eic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NT01EI_2846
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NT01EI_2846
  Exosomal proteins of melanoma cells
   NT01EI_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2738750..2739502
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLLRHGESEWNRENRFTGWTDVELSEKGRQEALAAGRLLKAQGFSFDIAYTSVL
KRAIHTLWHVLDKLDQPWLPVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRISAGERII
IAAHGNSLRALVKHLDHLSEGEIVELNIPTGVPLVYEFDKNMRPLHHYYLGDATEIAARQ
SAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcactaaactggttctgctccgccacggcgaaagcgaatggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaggggcgccaggaggcactggca
gcaggccgtcttctgaaggcgcagggattttcctttgacatcgcctacacctccgtgctt
aaacgtgccattcatactctgtggcacgtactggataagctcgatcagccgtggctgccg
gtggagaagtcatggaagctcaatgagcgtcactatggcgctctgcagggactgaacaag
gcagagaccgcgcagcagtacggcgatgaacaggtcaagctatggcgccgcgcctttgcc
atcaccccgccggccctgacgccggacgatccccgctatcccggtcacgatccgcgctat
gcggccctgagcgccgacgaactcccgctgaccgagagcctggccaccaccattgaacgg
gtgatcccctattggcagcagcagatagcaccacgtatctccgccggtgagcggatcatc
atcgccgcccatggcaattcgctgcgcgcgctggtaaagcatctggatcacctgagcgaa
ggcgagattgtcgagctgaatatcccgaccggcgttccgctggtatatgagttcgacaaa
aatatgcggccgctgcatcattattatctcggcgacgccaccgagattgccgcccgccaa
agcgccgtcgccaatcagggcaaggcaggctaa

DBGET integrated database retrieval system