KEGG   Edwardsiella ictaluri: NT01EI_2846Help
Entry
NT01EI_2846       CDS       T00912                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00010  Glycolysis / Gluconeogenesis
eic00260  Glycine, serine and threonine metabolism
eic00680  Methane metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
eic01230  Biosynthesis of amino acids
Module
eic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eic_M00002  Glycolysis, core module involving three-carbon compounds
eic_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_2846
  Energy metabolism
   00680 Methane metabolism
    NT01EI_2846
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01EI_2846
Enzymes [BR:eic01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NT01EI_2846
Membrane trafficking [BR:eic04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NT01EI_2846
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NT01EI_2846
  Exosomal proteins of melanoma cells
   NT01EI_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACR70013
UniProt: C5BEL3
Position
2738750..2739502
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLLRHGESEWNRENRFTGWTDVELSEKGRQEALAAGRLLKAQGFSFDIAYTSVL
KRAIHTLWHVLDKLDQPWLPVEKSWKLNERHYGALQGLNKAETAQQYGDEQVKLWRRAFA
ITPPALTPDDPRYPGHDPRYAALSADELPLTESLATTIERVIPYWQQQIAPRISAGERII
IAAHGNSLRALVKHLDHLSEGEIVELNIPTGVPLVYEFDKNMRPLHHYYLGDATEIAARQ
SAVANQGKAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcactaaactggttctgctccgccacggcgaaagcgaatggaaccgggaaaac
cgcttcaccggctggaccgacgttgaactgtcagagaaggggcgccaggaggcactggca
gcaggccgtcttctgaaggcgcagggattttcctttgacatcgcctacacctccgtgctt
aaacgtgccattcatactctgtggcacgtactggataagctcgatcagccgtggctgccg
gtggagaagtcatggaagctcaatgagcgtcactatggcgctctgcagggactgaacaag
gcagagaccgcgcagcagtacggcgatgaacaggtcaagctatggcgccgcgcctttgcc
atcaccccgccggccctgacgccggacgatccccgctatcccggtcacgatccgcgctat
gcggccctgagcgccgacgaactcccgctgaccgagagcctggccaccaccattgaacgg
gtgatcccctattggcagcagcagatagcaccacgtatctccgccggtgagcggatcatc
atcgccgcccatggcaattcgctgcgcgcgctggtaaagcatctggatcacctgagcgaa
ggcgagattgtcgagctgaatatcccgaccggcgttccgctggtatatgagttcgacaaa
aatatgcggccgctgcatcattattatctcggcgacgccaccgagattgccgcccgccaa
agcgccgtcgccaatcagggcaaggcaggctaa

DBGET integrated database retrieval system