KEGG   Edwardsiella ictaluri: NT01EI_2866Help
Entry
NT01EI_2866       CDS       T00912                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP forming), beta subunit, putative
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00020  Citrate cycle (TCA cycle)
eic00640  Propanoate metabolism
eic00660  C5-Branched dibasic acid metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
Module
eic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT01EI_2866
   00640 Propanoate metabolism
    NT01EI_2866
   00660 C5-Branched dibasic acid metabolism
    NT01EI_2866
Enzymes [BR:eic01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NT01EI_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACR70027
UniProt: C5BEM7
Position
complement(2754069..2755235)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAQYGLPTPEGYACSTPCQAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KCVESKEAIHAFAEQWLGKRLVTYQTDAHGQPVRQILVEGATEIARELYLGAVIDRSSRR
VVFMASTEGGVEIEQVAQKTPHLIHRVALDPLTGPQPYQGRELAFKLGLSGKQAQQFGQI
FLGLATLFLQCDLTMAEINPLVITPQGDLLCLDGKLDVDSNALFRQPTLLEMEDPAQNDA
REAHAAQWELNYVALEGNIGCMVNGAGLAMGTMDIVKLHGGAPANFLDVGGGATKERVTE
AFKIILSDEHVRAVLVNIFGGIVRCDLIADGIIGAVAEVGVHVPVVVRLEGNNAELGTRI
LADSGLNIIAATSLTDAARQVVSAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaggcgaaacagctgtttgcccagtatggattgccgacgccg
gaggggtatgcctgcagtacgccgtgtcaggcggaagaggcggcctctaaaatcggcagc
ggcccctgggtggtcaagtgtcaggtgcacgccggtgggcggggtaaggcgggcggtgtg
aagtgcgtggagagtaaagaggcgatccatgcttttgccgaacagtggctgggtaagcgt
ttggtgacctaccagaccgatgcccatgggcagccggtgcgccagattctggtggagggg
gcgaccgagattgcgcgtgagctgtatctgggggcggttatcgatcgcagctcccggcgt
gtggtgttcatggcatcgactgaggggggggtggagattgaacaggtggcgcaaaagacg
ccccatctgatccacagggtagcgcttgatccgctgaccggcccgcagccctatcagggg
cgcgagctggcgtttaagctggggctgagtggtaagcaggctcagcagtttggccagatt
ttcctgggactggcgacgctgtttttgcagtgcgatctgaccatggcggagatcaacccg
ctggtgatcaccccgcagggggatctgctgtgcctggacggtaagctggacgttgacagc
aatgccctgttccgtcagccgacgctgctcgaaatggaggatcctgcgcagaacgatgcg
cgtgaggcgcatgctgcacaatgggagctgaactacgttgcgctggagggcaacatcggc
tgtatggtgaacggcgccggtctggcgatgggcaccatggatatcgtcaagctgcacggc
ggcgcaccggctaacttcctggacgtgggcggtggtgccaccaaggagagggtgacggag
gcatttaagatcatcctgtccgacgagcacgttagggcggtgctggtcaatattttcggc
ggtatcgtgcgctgcgacctgatcgccgacggcatcatcggtgccgtggccgaggtgggc
gttcacgtaccggtagtggtacgtctggagggcaacaacgccgagctgggcacccgaata
ctggccgacagcggcctgaatatcattgcggccaccagtctgacggatgccgcgcgccag
gtggttagcgccgtggaggggaaataa

DBGET integrated database retrieval system