KEGG   Edwardsiella ictaluri: NT01EI_2867Help
Entry
NT01EI_2867       CDS       T00912                                 

Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eic  Edwardsiella ictaluri
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_2867
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT01EI_2867
  Amino acid metabolism
   00310 Lysine degradation
    NT01EI_2867
Enzymes [BR:eic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NT01EI_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2755325..2756536)
Genome map
AA seq 403 aa AA seqDB search
MSSVEILVPDLPESVADATVATWHKQVGDSIGRDEVIVEIETDKVVLEVPAAEAGVLEAI
LEPEGTTVTARQLLGRLRPADVSGVAIAGGAQTAASTPAERHTAALDTGSSDALSPAVRR
LVAEHGVDPASLQGSGVGGRLTREDVTKHLAGQQSTAPVAASPQAAAPLSAGREKRVPMT
RLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRSQYGEVFEKRHGVRLGFMSFYIKAV
LEALKRYPEVNAALDGEEVVYHNYFDISIAVSTPRGLVTPVIRDVDTLSMADIEKQIKAL
ALKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGQV
VILPMMYLALSYDHRQIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgtagaaattctggttcccgatctgcctgaatccgtcgccgacgccacggta
gccacttggcataagcaggtgggcgatagcatcggccgcgatgaggtcatcgtcgagata
gagacggacaaagtggtcctggaagtgccggcggcggaggccggcgtgttggaggctatc
ctggagccggaggggacgacggtaacggcgcgccagctgttgggacggctgcgtccggcc
gacgtgagcggcgtcgcgatcgccggtggggcgcagacggcagcatcgacaccggctgag
cgccataccgccgctctggatacgggcagcagcgatgccctgagccccgcggtgcgtcgt
ctggtcgccgaacatggcgtagatccggcatcgctgcagggcagcggtgtcggcgggcgt
ctgacgcgggaggatgtcacgaagcatttggccgggcagcagagcacagcgccggttgct
gcgtcacctcaggccgctgcgccgctgagcgcggggcgtgagaagcgggtacccatgacc
cgcttgcggaaacgggtggccgagcgcctgctggaggcgaaaaacagcactgcgatgctg
accaccttcaatgaagtgaacatgaagccgatcatggatctgcgcagccagtacggtgag
gtgtttgaaaaacgtcacggcgtgcgcctgggctttatgtccttttatatcaaggcagta
ttggaggcgttaaaacgttatccggaggttaacgccgctcttgacggtgaagaggtggtc
taccacaactactttgatatcagtattgcggtgtcgacgccgcgcggactggttacgccg
gtgatccgcgatgtcgataccctgagcatggcggatattgaaaaacagattaaagcgctg
gcgctgaaggggcgtgacggaaaactgacggtggaggagctgaccggcggtaactttacc
attaccaacggcggcgtattcggctctctgatgtccacgccgattatcaatccgccgcag
agcgctatcctgggaatgcatgccattaaggatcgcccgatggcggtagacggccaggtg
gtgatcctgccgatgatgtacctggcgctctcgtatgaccatcgccaaattgacgggcga
gagtccgtgggtttcctggtgacggtaaaagagatgttggaagatccggcgcgtctgctg
ctggatgtgtaa

DBGET integrated database retrieval system