KEGG   Edwardsiella ictaluri: NT01EI_2871Help
Entry
NT01EI_2871       CDS       T00912                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein, putative
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
eic  Edwardsiella ictaluri
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_2871
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NT01EI_2871
   00650 Butanoate metabolism
    NT01EI_2871
  Energy metabolism
   00190 Oxidative phosphorylation
    NT01EI_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2762163..2762510)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIVITLYVIYLLAFVVGAGPLNYTLWLDFFSSRITQVF
TLLTLLCILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLIYGTLVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatcggcgctggggcgcaacggtattcaggattggctgctgctgcgt
gcatccgccatcgtcatcacgctgtacgttatctatctgctggcttttgtggtcggcgca
ggcccactcaactatacattgtggcttgacttcttctcttcgcggatcacccaggtgttt
accctgctgaccttgctgtgcatcctgatccatgcctggatagggatgtggcaggtattg
accgactatgtcaagccgctggcgttgcgcctggtgctacagctggcgatcgtggtggtc
ctggtggtctatctgatttatggaacattggttgtgtgggggatatag

DBGET integrated database retrieval system