KEGG   Edwardsiella ictaluri: NT01EI_2903Help
Entry
NT01EI_2903       CDS       T00912                                 

Definition
(GenBank) glycosyl hydrolase family 20 protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00511  Other glycan degradation
eic00520  Amino sugar and nucleotide sugar metabolism
eic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NT01EI_2903
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NT01EI_2903
Enzymes [BR:eic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NT01EI_2903
Chaperones and folding catalysts [BR:eic03110]
 Intramolecular chaperones
  Others
   NT01EI_2903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ACR70064
UniProt: C5BGA1
Position
complement(2792575..2795241)
Genome map
AA seq 888 aa AA seqDB search
MKGYKLSVVATALGMLGVSGVAQADQQLVDSISSQVKVNYAVTDNRGAENGVNCAALGAD
WASCNQAVISLTNDGSAIEGKEWAIYFHNIRQILKSGNEQFKITFITGDLHKIEPTDKFK
GFAAGERIEIPIVGEYWQLFESDVMPRWYVTSPDAKPKVIANTDTEDLRQFVTPFAGDLW
KRIKDDKNVLMTPENRFAKNADVQTLSAASLRGQIMPTPLKLKVHQQDADLARGVSLDLT
VLNTASADVIKQRLGQLGVSQVQKGYPIKTLIATKAFKGDMAVPGAYQLKIGTKGAEVTG
YDQAGVFYGLQSILSLLPANGSAKIATLDAEDAPRFQYRGIELDVGRNFHSLASIERLLD
QMAAYKLNKFHFHLTDDEGWRIEIPGLPELTEVGGKRCHDLSEQQCLLPQLGSGPDSNNN
GSGYFTRADYIKLLKYAQARHIEVIPEIDMPAHARAAVVAMEARYNKLKAAGDEKGANEY
RLLDPTDDSNTTSVQFYDRHSYLNPCLDSSKRFVDKVIGEMAQMHREAGQPLTTWHFGGD
EAKNIRLGPGYTDVSKPEPGKGMIDLSKEDKPWAKSQMCQAMIKEGKVADMEHLPSYFAV
EVSKMVKDHGIGKMQAWQDGLKDAKDSKAFATPRVGVNFWDTLYWGGFDSANDWANKGYE
VVISNPDYVYMDFPYEVNPQENGYYWGTRFSDERKIFAFAPDNLPQNAETSVDRDGNYFS
AKSDKPWPGAYGLSAQLWSEVVRTDEMMEYKIYPRIMAVAERAWHQAGWEQPYQAGREYK
GGETHLVDQKALLQDWQRFANLMGQRELAKMDKSGVAYRVPQPGARVVNGKLETNVAMPG
LIVEYSVDGGKQWQRYDAKAKPSVSGEVQVRTASPDGKRFSRVESVKS
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatataaactgagcgtagtcgccacggcactgggtatgctgggcgtttccggt
gtagcgcaggccgatcagcagctggtggacagcatcagcagccaggtgaaagtgaactac
gccgtcaccgataaccgtggcgcggagaacggtgtcaactgtgcggcgctgggtgccgac
tgggcctcctgcaaccaggccgtgatcagcctgaccaacgatggcagcgctatcgagggt
aaagagtgggccatctacttccataacatccgccagatcctcaagagcggcaacgagcag
ttcaagatcaccttcattaccggcgatctgcacaagattgagccgacggataagttcaag
ggctttgccgcgggtgagcgcatcgagatccccattgtcggcgaatactggcagctgttt
gaaagcgacgtgatgccgcgctggtacgtgacctcaccggacgccaagccgaaggtgatc
gccaataccgataccgaagatctgcgtcagttcgtgacaccgtttgccggcgatctgtgg
aagcgtatcaaggacgataaaaacgttctgatgacgccggagaaccgctttgccaaaaat
gccgatgtgcagaccctgtcagcagccagcctgcgcggccagatcatgccgacgccgctg
aagctgaaagtacatcagcaggatgccgatctggcgcgtggcgttagcctggatctgacg
gtgttgaacaccgccagcgccgatgttatcaagcagcgtctgggccagcttggcgtgagt
caggtgcagaagggctacccgatcaagacgctgatcgccaccaaagcctttaaaggtgat
atggcggtaccgggcgcgtaccagctgaagatcggcaccaagggcgcggaagtgaccggc
tacgatcaggccggggtattctacggtctgcagtccatcctgtcgctgctgccggccaat
ggcagcgccaagatagcgaccctggacgccgaggatgcgccgcgcttccagtatcgtggc
attgagctggacgtggggcgtaacttccactctctggcctccattgaacgcctgctggat
cagatggcggcgtataagctgaataagttccatttccatctgaccgatgacgaaggctgg
cgtattgagatcccgggcctgccggagctgactgaagttggcggaaagcgttgccatgac
ctgagtgaacagcagtgtctgctgccgcagctgggttctggcccggacagcaacaacaac
ggcagcggctactttacccgcgccgactatatcaagctgctgaagtatgcccaggcgcgc
cacattgaggtgatcccggagatcgacatgcctgcccacgcccgtgcggcggtggtggcg
atggaggcccgttacaacaagctcaaggccgccggtgatgagaagggcgccaacgagtac
cgcctgctggatccgaccgatgactccaacaccacctcggtgcagttctacgatcgtcac
agctacctcaacccgtgtctggattcctccaagcgctttgtcgacaaagtgatcggtgag
atggcccagatgcaccgcgaagccggtcagccgctcaccacctggcacttcggcggcgat
gaggcgaagaacatccgcttagggccgggttacaccgacgtgagcaagccggagccgggc
aaggggatgatcgacctgagcaaagaggacaagccgtgggccaagtctcagatgtgccag
gcgatgatcaaagagggcaaggtggccgacatggagcacctgccgagctactttgcggtt
gaagtcagcaagatggtcaaggatcacggcatcggcaagatgcaggcctggcaggatggc
ctgaaggatgccaaggactctaaggcatttgcgacgccgcgcgtcggggttaacttctgg
gataccctgtactggggcggctttgactcagccaacgactgggccaacaagggctatgag
gtggtgatctccaacccggattacgtctatatggacttcccatatgaggtcaatccgcag
gagaacggctactactggggcacccgcttcagcgatgaacgcaagatctttgccttcgcg
ccggataacctgccgcagaacgccgaaacgtcggtcgatcgcgacggtaattacttcagc
gccaagagcgacaagccgtggccgggcgcctatggcctctctgctcagctgtggagtgaa
gtggtgcggactgatgagatgatggagtacaagatctatccgcgcatcatggctgtcgcc
gagcgtgcctggcatcaggcgggctgggagcagccgtatcaggccgggcgtgaatacaag
ggcggtgaaacccatctggtggatcagaaggctttgctgcaggactggcagcgttttgcc
aacctgatggggcagcgtgagctggccaagatggacaagtctggcgtggcctatcgcgta
ccgcagccgggcgcccgtgtcgtgaacggtaagctggagaccaacgttgcgatgccgggc
ctgatcgtggagtactctgtcgacggcggtaagcagtggcagcgctatgatgccaaggcg
aagccgagtgtgagcggtgaggttcaggtgcgtaccgcatcgccggatggcaagcgcttt
agccgcgtggagtccgtcaagtcctga

DBGET integrated database retrieval system