KEGG   Edwardsiella ictaluri: NT01EI_2913Help
Entry
NT01EI_2913       CDS       T00912                                 

Definition
asparagine synthase (glutamine-hydrolyzing), putative (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eic  Edwardsiella ictaluri
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eic00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2807016..2808677
Genome map
AA seq 553 aa AA seqDB search
MCSIFGVLDLKTDPQALRKTALEMSRLMRHRGPDWSGIYAGENAILAHERLSIVDVNTGA
QPLYNAQRTHVLAVNGEIYNHQALRERLGDRYAFQTGSDCEVILALYQEYGPDFLDQLRG
MFAFILYDAERDAYLIGRDHLGIIPLYMGHDEHGNLFVASEMKALVPVCRTLREFPAGSA
LWSRDGEIRRYYRRDWFDYAAVEHNPTDADVLRCALEESVKSHLMSDVPYGVLLSGGLDS
SIISAITKKFAARRVEDGERSAAWWPQLHSFAIGLQGAPDLKAAQEVANHLGTVHHEIHF
TEQEGMDAIRDVIYHIETYDVTTIRASTPMYLMARKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAKEFHDETVRKLLALHMYDCARANKAMAAWGVEARVPFLDKTFLDVAMRLNPRD
KMCGNGRIEKQLLRECFESYLPASIAWRQKEQFSDGVGYSWIDSLKAAAAAQVSDQTLAN
ARFRFPYNTPTSKEAYLYRDIFEQLFPLPSAAECVPGGPSVACSSAKAIEWDESLRKMDD
PSGRAVGVHKSAY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatctttggagtgctcgacctgaaaaccgacccacaggcgctgcgcaaaaca
gcgctggagatgtcccgcctgatgcgccaccgcggcccggactggtccggcatctatgcc
ggtgaaaacgccattctggcccacgagcgcctgtctatcgtcgacgtcaacaccggcgcc
cagccgctgtataacgcacagcgcacccatgttctcgcggtcaacggcgaaatttacaac
caccaggcgctgcgcgagcgcctcggcgatcgctatgcgtttcagaccggctccgactgt
gaggtgatcctggcgctgtaccaggagtatggtccggacttcctcgaccagctacgcggc
atgtttgcctttattctgtatgacgccgaacgggatgcctatctgatcggccgcgatcac
ctggggatcatcccgctgtacatgggacacgatgaacacggcaatctatttgtcgcctca
gagatgaaggcgctggtgccggtatgtcggacgctgcgcgaattcccggccggcagtgcc
ctgtggagccgcgacggcgaaatccgccgctactacaggcgcgactggtttgactacgcc
gccgtcgaacataaccctaccgacgctgacgtgctgcgctgtgcgctggaagagtcagtc
aaaagccatctgatgtctgacgtgccctacggcgtactgctctccggcgggctggactct
tcgattatctctgccatcaccaagaagttcgccgctcgccgcgtcgaggacggcgagcgc
agcgccgcctggtggccacagctgcactcctttgccatcggcctacagggcgcgccggat
ctgaaggcggctcaagaggtcgccaaccatctcggcacggtacaccatgagatccacttc
accgagcaggagggaatggacgccatccgcgacgtgatttatcacatcgaaacctacgac
gtcaccaccatccgcgcctcgacaccgatgtacctaatggcgcgcaagatcaaggcgatg
gggatcaagatggtgctctccggcgaaggtgccgatgaggtgttcggcggctacctctat
ttccataaggcgcccaacgccaaagagtttcatgacgagacggtgcgcaaactgctggcg
ctgcacatgtatgactgcgcgcgcgccaacaaggcgatggccgcctggggcgtcgaagcc
cgggtaccgttcctcgataagacatttctcgacgtggccatgcgcctcaacccgcgcgac
aagatgtgcggcaacggacgcatcgaaaagcagctgctgcgcgaatgtttcgaatcctat
ctgccggccagcatcgcctggcgtcagaaagagcagttctccgacggcgttggctacagc
tggatagactcgctgaaagccgccgccgccgcccaggtcagcgaccagacgctggccaat
gcccgcttccgttttccctacaacacgccaaccagcaaggaggcctacctgtaccgcgat
atctttgagcagctgttcccgctgccgagtgccgcagagtgcgtccccggcggcccctcc
gtcgcgtgctcctccgccaaggccatcgagtgggacgaatccctgcgtaaaatggacgac
ccttccggccgcgccgtcggcgtacacaagtccgcctattaa

DBGET integrated database retrieval system