KEGG   Edwardsiella ictaluri: NT01EI_3015Help
Entry
NT01EI_3015       CDS       T00912                                 

Definition
acyl-CoA thioesterase I protein family (EC:3.1.2.- 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eic  Edwardsiella ictaluri
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NT01EI_3015
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NT01EI_3015
   3.1.2  Thioester hydrolases
    3.1.2.-  
     NT01EI_3015
Lipid biosynthesis proteins [BR:eic01004]
 Fatty acid synthase
  Component type
   NT01EI_3015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2902223..2902885
Genome map
AA seq 220 aa AA seqDB search
MMNFNDVLRWHRILLIVVMILCGLTAARADTLLVLGDSLSAAYRLPEQQGWVARLAQQWQ
RRTPPLTVINASISGDTAGQGLLRLPALLQQHRPRWVLIELGANDGLRGVAPDAIAATLS
AVIGQVQQTGATPLLMQIRLPPNYGRRYGDAFAAIYPQLAARFNATLLPFYMEAVVGHPD
WIQNDGLHPNALAQPFIADWMAQRLLPQLTRAEDGAPSIN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaatgacgttttgcgctggcatcggatactcctgatagtggtcatgatc
ctgtgtggcctgacggcagcccgtgccgatacactgctggtgctgggggacagcctgagc
gccgcctatcgcctgccggagcagcagggctgggtcgcacgtctggcacagcaatggcag
cggcgtaccccgccgctgacggtgatcaacgccagcatcagcggcgataccgccgggcag
ggcctgctgcgcctgccggcgctgctgcagcagcaccggccgcgctgggtgctgattgag
ctgggggccaacgatgggctacgcggcgttgctcctgacgccatcgccgcgacgctgtcc
gctgtcatcggacaggtgcagcagactggcgccacgccgctgctgatgcagatccgcctg
ccgcccaactacggccggcgctacggcgacgcctttgcggctatctaccctcagctggca
gcgcgctttaacgctacactgctgccgttttatatggaggcggtggtcggccatcccgac
tggatccagaatgacggcctgcaccccaacgcgctggcccagccatttatcgccgactgg
atggcgcagcgcctgctgccgcagctaacgcgcgcggaggacggcgcgccgtctattaat
taa

DBGET integrated database retrieval system