KEGG   Edwardsiella ictaluri: NT01EI_3263Help
Entry
NT01EI_3263       CDS       T00912                                 

Definition
alkaline phosphatase, putative (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
eic  Edwardsiella ictaluri
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eic00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:eic00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eic02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3140864..3142309)
Genome map
AA seq 481 aa AA seqDB search
MASHTPFSLSLLMFSLGLALPLQAAPAAPSAEQVLTERAAHGDITQRGGARRLLGDQTAA
LQASLSTRPAKNVILLIGDGMGDAEITAARNYAAGAGGMLRGIDALPLTGQYTHYALDRK
THKPDYVTDSAASATAWSSGVKTYNGALGIDVTGKPYPTLLEMARAAGKATGNVSTAELQ
DATPAAMFAHVSGRKCYGPQQTLEKCPENALENGGAGSISEQMLKARADVTLGGGAKTFT
QIVGAGEYKGKTLLQQAQAQGYHIVNDLVGMDAVTVADQKRPLLGLFAEGNMAVRWLGPK
ASLHGNLEQAPVTCQPNPQRSDSQPTLAQMTGKAISLLSKNPNGFFLQVEGASIDKQDHA
ANPCGQFGETVDLDEAVQKALEFARRDGNTLVVVTADHAHSSQIIPNDAKAPGLTQTLIT
QDGVPMTISYGTAEEADSQEHTGSQIRIAAYGPHAGNVVGLTDQTDLFFTLRDAMGLNAA
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccatacccctttctccctttctctgctgatgttttctcttggtcttgccctg
ccgctgcaggccgcgcccgctgcgccgagcgcagagcaggtgcttaccgaacgcgccgcg
cacggcgatattacccagcggggaggcgcccgccgcctgctcggcgatcagacagctgcg
ctgcaggcgtcgctgagtacccgcccggccaagaacgtgatcctgctgatcggcgatggc
atgggagatgcggagatcaccgccgcccgtaactatgcggccggcgcgggcggaatgctg
cgcggtatcgatgccctaccgctgaccgggcaatacacgcactatgccctggatcgtaaa
acccataaaccggactatgtgacggactctgcggcatcggctaccgcctggagcagtggg
gtgaaaacctataacggcgcattgggtattgatgtaacaggtaaaccttatccgacgctg
ttggagatggcgcgtgcagcgggcaaggccaccggaaacgtctcgaccgcagagctgcag
gacgccacgccggcggcgatgttcgcccacgtcagcggacgcaaatgttatggcccgcag
cagaccctggagaaatgtccggagaatgcgttggaaaacggtggggctggctcgatcagc
gaacaaatgttgaaagcgcgggccgatgtgacgctgggcggcggtgcaaaaacgtttacc
cagatagtgggggccggtgagtataagggtaagacgttgctccagcaggcacaggcgcag
gggtaccacatcgttaacgatctggtgggtatggatgcggtgacggtggcagatcagaag
cgtcctttgctggggctgttcgccgagggcaatatggcggtgcgttggctggggccaaaa
gccagtctgcacggtaacctggagcaggcgccggtcacctgccagccgaatccgcagcgc
agtgacagccagccgacgctggcacagatgaccggcaaagccatttcgcttttgagcaag
aatccaaatggtttcttcctgcaggtcgaaggtgcttctatcgataaacaggatcatgcc
gccaatccgtgcggtcagtttggtgagacggtcgatttggatgaggcggttcaaaaggcg
ctggagtttgcccgccgtgacgggaataccctggtagtggtaacggcggatcatgctcat
agcagccagattatccccaacgatgccaaggcgccggggctgactcagacgcttatcacc
caggatggggtaccgatgaccattagctacggcaccgctgaggaggcggacagccaggag
cataccggctcccagatacgtatcgctgcgtatggtcctcatgccggtaacgtagtgggg
ctgacggatcagacggatctgttctttaccctgcgcgatgcgatgggacttaacgccgcg
aaataa

DBGET integrated database retrieval system