KEGG   Edwardsiella ictaluri: NT01EI_3341Help
Entry
NT01EI_3341       CDS       T00912                                 

Definition
thiol:disulfide interchange protein DsbC, putative
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eic  Edwardsiella ictaluri
Brite
Enzymes [BR:eic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NT01EI_3341
Secretion system [BR:eic02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NT01EI_3341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3226594..3227310)
Genome map
AA seq 238 aa AA seqDB search
MKKSVIWLALLAASVSGLARADDAAIQQSLKKLGIQQAQIQASPVAGLKTVFSEGGVLYV
TDDGKHILQGPMYDVSGAVPENVTNQLLMKRLDKLAPEMIVYKAPKQKYVITVFTDITCG
YCHKLHSQIKEYNDLGITVRYLAFPRQGPDSKAEKDMQSIWCMADRRKAFDDALKGETIS
PATCDVNIKSHYALGVQFGIQGTPAIVLSNGMVIPGYQGPKEMLAMLDAQAQMSQKKG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcgtgatttggttggcattactggcggcgtccgtcagcggcctggcccgg
gcagatgatgccgcgatccagcagtcgctgaaaaagctggggatccagcaggcgcagatt
caggcgtcaccggtggccggtctgaagacggtcttcagcgaaggcggcgtgctgtatgtt
acggacgatggcaagcatatcctgcaggggccaatgtatgacgtcagcggcgcggtgccg
gagaacgtgaccaatcagctgctgatgaagcgcctggacaagctggctccggagatgatc
gtctataaggcgccgaagcagaagtatgtgatcaccgtctttaccgatattacctgcggc
tactgccataagctgcactcccagattaaggagtacaacgatctggggatcaccgtgcgc
tatctcgccttcccgcgtcaggggccggactccaaggcagagaaggatatgcagtctatc
tggtgcatggcggatcgccgtaaagcctttgacgatgcgctgaagggggagacgatttca
ccagcgacctgtgatgtgaacatcaagtctcactatgcgctgggcgtgcagtttggcatt
cagggtacaccggcgatcgtgttgagcaacggaatggtgatccccggctatcaggggccg
aaagagatgctggcgatgctggatgcccaggctcagatgagccagaagaaaggttaa

DBGET integrated database retrieval system