KEGG   Edwardsiella ictaluri: NT01EI_3373Help
Entry
NT01EI_3373       CDS       T00912                                 

Definition
agmatinase, putative (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eic  Edwardsiella ictaluri
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NT01EI_3373
Enzymes [BR:eic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NT01EI_3373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3260616..3261530)
Genome map
AA seq 304 aa AA seqDB search
MCTLGHKPDNSLVSNAFGFLRLPLDFMPYDGDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEGKRWPWNFDMRDRLKVVDCGDVVFSFGDAQEMSDNLQAHAERLLASGKRCL
TFGGDHFITLPLLRAHAKHFGKMALVHFDAHTDTYAHGSKFDHGTMFFHAPNEGLIDPQH
SVQIGIRTEYDHDNGFTVLDAAQVNDRSVEDVLAEVKRIVGDLPVYLTFDIDCLDPAHAP
GTGTPVIGGLTSDRALKLVRGLQDLDIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgtactctggggcataagcctgataactctctggtatccaacgcctttggtttcctg
cgtctgccgctggacttcatgccgtatgacggcgacgccgactgggtgatcaccggagtg
ccgttcgatatggcgacctccggccgcgccggtggccgacacgggccggcggctatccgt
caggtttccaccaacctggcctgggaaggcaagcgctggccgtggaacttcgatatgcgc
gaccgcctgaaggtggtggactgcggcgacgtggtcttcagtttcggcgacgcccaggag
atgagcgataacctgcaggctcacgccgagcgtctgttggccagcgggaaacgctgcctg
acctttggcggtgaccattttatcaccctgccgctgctgcgcgctcacgccaagcacttc
ggcaaaatggcgctggtgcacttcgacgcccacaccgatacctatgcgcacggcagcaag
ttcgatcacggcaccatgttcttccatgcgccgaacgaggggctgatcgatccgcagcat
tcggtgcagatcggtattcgcaccgagtacgatcatgacaacggttttaccgtgctggat
gccgcccaggtgaacgatcgcagcgtagaggatgtgctggccgaggttaagcgtatcgtc
ggtgatctgccggtttatctgacttttgacatcgactgcctggatccggcccatgccccg
ggcaccggcacaccggtgatcggcggcctgacctccgatcgcgccctgaagctggtgcgt
ggcctgcaggatctggatattgtcggcatggacgttgtcgaagtcgcgccggcctatgat
cagtcagagatcaccgccctggcggcggcgacgctggcgctggagatgctgtatatccag
gcggcgaagaagtaa

DBGET integrated database retrieval system