KEGG   Edwardsiella ictaluri: NT01EI_3422Help
Entry
NT01EI_3422       CDS       T00912                                 

Definition
glycosyl hydrolase family 4 protein (EC:3.2.1.-)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
eic  Edwardsiella ictaluri
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eic00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eic00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3307392..3308771)
Genome map
AA seq 459 aa AA seqDB search
MSKITLIGAGSIMFSRQIISALLSSPVLAGSEIILMDLDEQVLARSQRLIGMMVAQSGVP
VTVRHTTDRRSALRGADFVINAIQVGGLAPWRLDMEIPARYGVIQEVGDTLGPGGIFRAL
RHIPPMLDILRDMEDLCPQALFINYANPLAPLTWAAKEASGVRSIGLCYGVRYTVAQLVG
YLGLGPWVDHPSTPQRWQRLMYHEVPADIAYEFAGINHMTWITALSRHGEDLLPRVRALA
DDARTRQADGVRCEVLRFFGLWCTENHWHCSDYLPYFRKNPQMIDRFLPQRWNLLALEEQ
VHAAGQAEIDAQLAGERPFVIAPNMLNAPKLISAQLSGERIRINGNMANRQPQGLLVENL
PAECVVEVPVWVDGDGLHPQTMGRLPTQCASLCKSNIAVQELVVQAALTGDLDAARYALS
LDPLTAAVCTLDQIQSMFDALFAAQRQWLPQFDAAQASA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcaccctgatcggcgcgggcagtattatgttttcgcgtcagatcatttcc
gccctgctgtccagcccggtgctggcgggcagcgaaatcatcctgatggatctggatgaa
caggtgctggcgcgcagccagcgcctgatcggtatgatggtggcacagtcgggggtgccg
gtgacggtacgccacaccaccgacagacgcagcgcgctgcgcggcgccgactttgtcatc
aacgccattcaggtgggcgggctggcaccctggcggctggacatggagattccggcgcgc
tacggcgtgattcaggaggtgggtgacaccctggggcccggcggtatcttccgcgccctg
cgccatattcccccgatgctggatattctgcgcgatatggaggatctgtgcccgcaggcg
ctgttcatcaactatgccaatccgctggcgccgttgacctgggcggccaaagaggccagc
ggcgtgcgcagcatcggcctgtgctatggagtgcgctataccgtggcgcagctggtcggc
tatctggggctggggccgtgggttgaccacccctccacaccgcagcgctggcagcgcctg
atgtatcacgaggtcccggccgatatcgcgtatgagtttgccgggatcaaccacatgacc
tggattacggcgctgtcacgccatggtgaggatctgctgccgcgggtgcgggcactggcc
gatgacgcgcgtacccgccaggctgacggggtacgttgcgaggtgctgcgcttcttcggc
ctgtggtgtaccgagaaccactggcactgcagcgactatctgccctacttccgcaagaat
ccgcagatgatcgatcgcttcctgccgcagcgctggaacctgctggcgctggaggagcag
gtgcatgccgccggccaggcggagatcgatgcccagctggccggcgagcgtcctttcgtt
atcgcgccgaacatgctcaacgcgcccaagctgatcagtgcacagctcagcggtgagcgc
atccgtatcaacggcaatatggccaaccgtcagccgcaggggctgctggtggagaatcta
ccggcggagtgcgtggtggaggtgccggtttgggtcgacggtgacgggctgcacccccag
acgatggggcgtctgccgacccagtgcgccagcctgtgtaagagcaatatcgcggtgcag
gagctggtggtgcaggcggcgctgaccggcgatctggacgcggcgcgctatgcgctctct
ctcgatccgctgaccgccgccgtctgtaccctggatcagatccagtcgatgttcgacgcg
ctgtttgccgcccagcggcagtggctgccgcagtttgacgccgcacaggcgtcagcctga

DBGET integrated database retrieval system