KEGG   Edwardsiella ictaluri: NT01EI_3620Help
Entry
NT01EI_3620       CDS       T00912                                 

Definition
ribulose-phosphate 3-epimerase, putative (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
eic  Edwardsiella ictaluri
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:eic01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eic01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eic00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:eic00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3506975..3507652)
Genome map
AA seq 225 aa AA seqDB search
MNPYLIAPSILSADFARLGEDTAKVLAAGADVVHFDVMDNHYVPNLTIGPMVCKALREYG
ITAPIDVHLMVKPVDRIIPDFADAGASIITFHPEASDHVDRTLQLIRACGCKAGLVLNPA
TPLSCLDYVMDRLDTILLMSVNPGFGGQSFIPSTLDKLRQVRQRIDASGLDIRLEVDGGV
KVDNIGAIAAAGADMFVAGSAIFGHADYAAVITDMRHEIAQACHE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtatttaattgccccgtcgattttgtccgcagactttgcccggctgggcgaa
gatactgccaaggtgttggccgccggtgccgatgtggtgcactttgatgtcatggataac
cactatgtgccgaatttgaccattggtccgatggtctgcaaagcgctacgggagtatggc
atcaccgctccgatcgatgttcacctgatggtgaagccggtcgatcggattatcccggat
tttgctgatgccggcgccagcattattaccttccatccggaggcatcggatcacgtcgat
cgcactctgcagctgatccgcgcctgtggctgtaaggcggggctggttctgaacccagcc
acgccgctgagctgtctggattacgtgatggatcgcctcgataccatcctgctgatgtcc
gtaaatccgggctttggcggccagtcctttattccgtcgaccctcgataagctgcgtcag
gtgcgtcagcgtattgatgccagcggtctggatattcgcctggaggttgacggtggcgtg
aaggtggacaatatcggtgctatcgcggcggctggcgccgatatgtttgttgccggctcg
gctattttcggtcacgccgactatgcggcggtgatcacggatatgcgtcatgagattgcg
caggcctgccatgaataa

DBGET integrated database retrieval system