KEGG   Edwardsiella ictaluri: NT01EI_3671Help
Entry
NT01EI_3671       CDS       T00912                                 

Definition
4-alpha-glucanotransferase, putative (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eic  Edwardsiella ictaluri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01EI_3671
Enzymes [BR:eic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NT01EI_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3559486..3561579
Genome map
AA seq 697 aa AA seqDB search
MQRTTPHTALEQQAAQAGIADSYINAHGRVQAISAQTKRRLLDAMPPRTPSDAPLPAVLV
AGQRSTPIIDLRQGGHYHWSLTLENGTQPAYQGRLSRRKHLVLPHNLPLGYHSLQLSDGQ
RQWQCRIIIAPARCHEPDALLTGRKLWGACVQLYTLRSAHNWGIGDFGDLAQLIGQIALR
GGAFVGLNPIHALYPANPHSISPYSPSSRRWLNIIYIDINQVDEFQRSTAAQRWWQKPST
RQRLDAARASTWVDYPAVYALKLEGLRLAFHTFNAQGADARAGAFRHFVCQGGDSLRHQA
AFDALHSHLYSEDKQMWGWPVWPPSLRRADSPEVARFCQQYPQEVTFFLWLQWLADSQLA
DCYQQACCQAMPIGLYRDLAVGVAEGGAETWSEPELYCLRASVGAPPDILGPLGQNWGLP
PMDPHTLRDLAYQPFVDMLRANMRHCGALRIDHVMSLLRLWWIPQGQRASEGSYVGYPLD
DLLTILALESQRSRCMVIGEDLGTVPVEIIAKLREYGVYSYKVLYFEHDSENTFRAPQTY
NVQAMATVTTHDLPTLNGYWQADDLRLGERLGLYPDAEVLAGLYRNRAAAKQGLLDGLHH
YDCLPQRSGRHADRMAMTPVLNRGIQRYVADSASALLGLQPEDWLNMAAPVNVPGTCDEY
PNWRRKLSMTLEDMFNNTQINELISDLDKRRKKVSAG
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcactacgccgcacaccgccctggagcagcaggcggcccaggcggggatcgcc
gacagctacatcaacgcgcacggccgcgttcaggccatcagcgcacagaccaaacggcgc
ctgctcgacgccatgccgccgcgtaccccctccgatgcgccgctgcctgctgtcctggtg
gccggacagcggagtacgccgatcatcgacctgcgtcaggggggccactaccactggtcc
ctcacgctggaaaacggaactcagcctgcctatcagggccggctgagtcggcgtaaacat
ctggtgctgccgcacaacctgccgctgggctaccacagcctgcaactcagcgatgggcag
cggcagtggcaatgccggatcattattgcaccggcgcgctgccatgagccggacgccctg
ttgaccggacgaaagctctggggcgcctgcgtacagctgtataccctgcgctccgcgcat
aactgggggatcggcgacttcggcgatctggcccagctgatcggacagatcgccctgcgc
ggcggcgcttttgtcggcctgaatccaatccatgccctgtatcccgccaacccgcacagc
atcagtccctacagcccatcatcacgccgctggctgaacatcatctacattgatatcaac
caggtcgacgagttccaacgcagcaccgccgcccagcgatggtggcagaaaccctcaacc
cgtcagcgtctggacgccgcacgcgccagcacttgggtcgattatcctgccgtatacgcc
ctgaaactggaggggctgcgcctggccttccacacgttcaacgcacagggcgccgatgcc
cgggccggcgccttccgtcactttgtctgccaagggggagatagcctgcgccaccaggcc
gcatttgacgccctgcacagccacctgtacagcgaagataagcagatgtgggggtggccg
gtctggccgccgtccctgcgccgcgccgatagccccgaggttgcccgcttctgtcagcaa
tatccgcaggaggtgacgttttttctgtggctacagtggctggccgatagccagctggcc
gactgttatcagcaggcctgttgccaggcgatgccgatcggactgtaccgcgatctggcg
gttggcgtcgccgagggcggcgcggagacctggagtgagcctgagctttactgcctgcgc
gcctcggtcggagccccgcccgacattctcggcccgctggggcaaaactggggactgccg
ccgatggacccccatacgctgcgcgacctcgcctatcaaccattcgttgacatgctgcgc
gccaatatgcgccactgcggtgccctgcgcatcgatcatgtgatgtcgctgctgcgacta
tggtggataccgcaaggtcagagggcgtcagagggatcctatgtcggctatccccttgac
gatctgctgaccattctggcgctggaaagccagcgtagccgttgcatggtcatcggcgaa
gatctcggcaccgtaccggtcgaaatcatcgccaagctgcgcgaatacggggtgtactcc
tacaaggtgctctactttgaacacgatagcgaaaacacctttcgagcgccgcagacctat
aacgtacaggccatggcgacggtgaccactcacgacctgccgacgctgaacggctattgg
caggccgacgatctacggcttggcgagcggctgggactctaccccgatgccgaagtcctg
gcagggctgtaccgcaaccgtgctgccgccaagcaagggttgctcgacggactgcaccac
tacgactgcctgccgcagcgcagcggacggcacgcggaccgtatggcgatgacgcccgtc
ctgaaccgcgggatccaacgctacgtggccgacagcgccagcgccctgctcgggctgcag
ccggaggattggctgaacatggctgcgccggtcaacgttcccggtacctgtgatgaatac
ccgaactggcgccgcaagctgagcatgacgcttgaggatatgtttaataatacgcaaatc
aatgaactgataagcgacttggacaagcggcggaaaaaagtctcggcgggctag

DBGET integrated database retrieval system