KEGG   Edwardsiella ictaluri: NT01EI_3674Help
Entry
NT01EI_3674       CDS       T00912                                 

Definition
1,4-alpha-glucan branching enzyme, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eic  Edwardsiella ictaluri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01EI_3674
Enzymes [BR:eic01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NT01EI_3674
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01EI_3674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3563578..3565788
Genome map
AA seq 736 aa AA seqDB search
MSVLPSTHKIQQLLAGQCADPFALLGMHTTAKGLAVRALMPEAESVQVVDRKNGRTLVTL
ERIHEGGFFCGLVPRRKNPFPYLLRVTWDNHQQLLEDPYRFGPLLGEIDNWLLKEGTHLR
PYERLGAHLTQLADIRGVSFAVWAPNAQRVSVVGNFNAWDGRRHPMRLRRESGIWELFIP
GIEAGELYKFELIDARGERVLKADPYAFEAQMRPDTASLVAPLPEKSAISAQRSAANGFS
APISIYEVHLGSWRRHSDNGYWLSYREMAEQLIPYVKEMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPQEFREFIDAAHAAGINVLLDWVPGHFPSDEWGLANFDGTALYEYA
DPREGFHQDWNTLIYNYGRYEVRNFLAGNALFWQERYGIDGLRVDAVASMVYRDYSRAAG
EWVPNCHGGNQNLEAIEFLRYTNRTLGEQHPGSVCMAEESTDFSGVTLPPDDGGLGFHFK
WNMGWMHDTLNYMKHDPVYRKYHHNLMTFGLLYAWSENFVLALSHDEVVHGKGSLLDKMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGGEFAQGREWNNESSLDWHLLEGEDNWHHGVQ
RLVRDLNLCYRSCGALHRWDCDARGFRWRVVDDDQNSVFAFVRRDDMGNEVLVVSNFTPV
PRHHYRIGVDLPGRYREILNTDSSHYHGSNSGNQGGVLSEAVGSHGCEYSIQLTLPPLST
LYLCLDNGDGDDAQAG
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacttcccagcactcacaagatccaacaactgctcgccggccagtgcgccgat
cccttcgctttgctggggatgcatacgacagccaaagggctggccgtgcgggcgctgatg
cccgaggcagaatcggtacaggtggtcgaccgtaaaaacgggcgcacgctggtcacgctg
gagcgcatccatgagggcggtttcttctgcggtctggtaccgcggcgtaagaatcccttc
ccttatctgctgcgcgtcacctgggataatcatcagcagctgctggaagatccctaccgt
ttcgggccattgttaggtgaaatcgataactggctgctcaaagaggggacccatctgcgt
ccctatgaacgattgggcgcccacctgacccaactggccgatatccgcggcgtcagtttc
gccgtctgggcacccaacgcccagcgcgtctccgtagtcggcaactttaatgcctgggac
ggacgccgccacccgatgcgcctgcgccgggaaagcggtatctgggagctgttcatcccc
ggcatagaggccggggagctgtacaagtttgagctgatcgacgcccgcggcgagcgggta
ctgaaagctgacccctatgcctttgaggcccagatgcggccggataccgcctcgctggtc
gctccgctgccggagaaaagcgccatcagcgcccaacgcagtgccgccaatggcttcagt
gctccgatctccatctatgaggtacacctcggctcctggcgtcgccacagcgacaatggc
tactggctgagctaccgggagatggccgagcagctcatcccctacgtcaaagagatgggg
tttacccatattgagctgctgccgatcaatgaacatcccttcgacggctcctggggctat
cagccgctggggttatacgccccgacccggcgctacggtactccgcaggagttccgcgaa
tttatcgatgccgcccacgccgccgggatcaatgtcctgctcgactgggttcccggccac
tttcccagcgacgagtgggggctggctaacttcgacggtacggcgctgtatgaatacgcc
gatccgcgcgaaggcttccatcaagactggaataccctgatctacaactatggccgctat
gaagtacgtaacttcctggcgggcaacgccctattctggcaggagcgctatggcatcgac
ggcctgcgcgtcgacgccgtggcctcgatggtctaccgcgactacagccgcgccgcgggc
gaatgggttcccaactgccacggcggaaaccagaatttggaggccatcgagttcctgcgc
tataccaacagaactctgggagagcaacaccccggcagcgtctgtatggctgaagagtcc
actgacttttccggcgtcaccctgccaccggacgatggcggcctgggcttccacttcaag
tggaatatgggctggatgcacgacaccctcaactacatgaagcacgatccggtctatcgt
aaatatcaccacaatctgatgaccttcggcctgctgtatgcctggagcgaaaattttgtg
ttggccctctctcacgacgaagtcgtgcacggcaagggctcgctgttggataaaatgccc
ggtgatgcctggcagaaattcgccaacctgcgcgcctactacggctttatgtgggcacat
cccggcaaaaaactgctgtttatgggcggggagtttgcccaggggcgcgaatggaacaac
gagtccagcctggactggcacctgctggagggcgaagacaactggcaccacggcgtacag
cggctggtacgggatctgaacctctgttatcgcagctgcggtgccctgcaccgttgggat
tgcgacgcgcgcggctttcgctggcgggtggtcgatgacgatcagaactcagtcttcgcc
tttgtccgccgcgatgatatgggcaacgaggtgctggtggtcagtaactttacgccggtc
ccccgtcaccattaccgtatcggcgtcgatctgccggggcgctaccgcgaaattctcaat
actgactccagccactaccacggcagcaacagcggcaatcagggcggcgtgctcagcgag
gcggtgggcagccacggctgtgagtactccatccaactgaccctgccgccgctgtcaacg
ctctatctgtgtctggacaatggggacggagacgatgctcaggccgggtaa

DBGET integrated database retrieval system