KEGG   Edwardsiella ictaluri: NT01EI_3719Help
Entry
NT01EI_3719       CDS       T00912                                 

Definition
lysophospholipase L2 family protein (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT01EI_3719
Enzymes [BR:eic01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NT01EI_3719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3605046..3606071)
Genome map
AA seq 341 aa AA seqDB search
MSSMIHGWLTRERGFAAFTTGPLLNFWQRRREAEFCGVDGIAIRYVAFCDARHTRAILIA
PGRIESYMKYPELAYDLFVSGYDVVIIDHRGQGTSERMLNDPHRGHVERFDDYVDDLQQL
WQRELLARPYRQRFLLAHSMGGAISALFLARRPAGLTAAALCAPMTGIRLPLPRWLAKGI
LTWAARRRERRTRYALGTGYWRPLPFMVNELTHSRVRYRRFLRYYSDYPRLQVGGPTYQW
VAESLAAAERVQRVAPEIVTPLLLLQAAEDRVVDNASQLRFCQTLAAAGNAPWGGAPLVI
KGARHEILFERDSQRAEAITAIMLFFKQFYESSAPIAANPS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatgatccacggctggctgacgcgtgagcgtggctttgctgcgtttacgacc
ggaccgctgctgaacttttggcagcggcgccgggaggccgaattctgcggcgttgacggc
attgcgatccgctacgtggccttttgcgatgcacggcacacccgcgcaatactgatcgcc
ccggggcgcattgaaagctatatgaaatatccggagctggcctacgatctgtttgtgagc
ggctatgacgtggtgatcatcgaccaccgcggccagggaacttccgaacggatgctgaac
gacccacaccgcggtcacgtggagcgcttcgacgactacgtggatgatctgcagcagttg
tggcagcgtgagctgctggcgcgcccctatcggcagcgttttttactggcgcattcgatg
ggtggtgctatcagcgccctgtttctggcccgccgccccgcggggctgaccgccgcggcg
ctgtgtgcgccgatgaccgggatccgtctgccgctgccgcgctggctggcgaagggcatc
ctgacctgggccgcgcgccgccgtgagcggcgcacccgctatgccttgggcacaggctac
tggcgccccctgccatttatggttaacgaactcacgcacagccgggtgcggtatcgtcgt
tttttgcgctattattctgactatccacggctgcaggtgggtgggccgacctatcagtgg
gtcgccgaaagcttggccgctgctgaacgggtccagcgcgtggcgccggagatcgtcacg
ccgctgctgctgctgcaggccgcagaggatcgcgtggtggataatgcgtcacagctgcgt
ttctgtcagacactcgctgccgccggcaacgccccctggggcggcgcgccgctggtcatc
aagggcgcacgtcatgagatcctgtttgaacgggacagccagcgtgccgaagcgataacc
gctatcatgctgttttttaaacaattttatgaatcgtcggcacctattgccgccaacccc
agctga

DBGET integrated database retrieval system