KEGG   Edwardsiella ictaluri: NT01EI_3757Help
Entry
NT01EI_3757       CDS       T00912                                 

Definition
(GenBank) glycosyl hydrolases family 8 protein (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eic  Edwardsiella ictaluri
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3643263..3644384)
Genome map
AA seq 373 aa AA seqDB search
MKESVYRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQVTTSEGQ
SYALFFALVNNDRALFGKLLAWTQNNLSQGSLSQRLPAWKWGRHDDGRWRILDDNSASDA
DLWIAYTLLEAGRLWQDSDYQHLSIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWT
INPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPHGIVPDWTNWQRNKGWLPTPGRA
YISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVGVLGVEPQGEGN
VGFSAAMLPFLDASNSPLLAAQRQRVKDNLPGNNNYYSSVLTLFGLGWDQRRYRFNLQGE
LVPNWGSVCDVSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtctgtttaccgtacactgatggccgctgcgttgctgtgtgtcagcgtcgcc
accgttggcgcaccctgtgaatggcatgagtgggagcagtttcgtcagggctatatcagc
cctgacgggcgggttatcgatcccagttctccccgccaggtaaccacctcggaggggcaa
agttatgcgctgttctttgccttggtcaataacgatcgcgcgttgttcggtaagttattg
gcatggacgcagaataatctgtcgcagggcagtctgagccagcgtttgccagcctggaag
tggggacgccatgatgacgggcgttggcgcatattggatgataactctgcctcggatgcc
gacctgtggatagcctatacgctgctggaggccgggcgcctgtggcaggattccgattac
caacatttgagtattcagctattggcgcggattgcccgggaggaggtggtctccttgccg
ggatttggcatgatgctgctgccgggtcgtcaggggttccgctctggcgctctgtggacg
ataaatccaagctacctgccaccgcagatcctggctcggattgcgccattgcatggaccg
tggaaccgtctgcagtacagcgcattgcgcatgttagaggcgtcgtcgccgcatggcatc
gtgccggactggacaaactggcagcggaataagggctggctgccgacgccggggcgggcc
tatatcagcggctatgatgccatccgggcctatctgtgggcgggaatgctggccgatggc
gctccggccaaaagcgcgctggtgaagcactggcagccgatggtggcgttgagtgagcgt
ctgggatatatccctgaaaaggtcggtgtactgggcgtagagccccagggtgaaggcaac
gttgggttctcggccgccatgttgccgtttctggatgccagcaacagtccgttattggcg
gcgcagcggcagcgggtaaaagacaacttgccggggaataataactactacagttcagtc
ctgacgctgtttggcctgggatgggatcagcggcgttaccgttttaatctacagggtgaa
ctggtgccaaactggggttccgtatgcgatgtttccgactga

DBGET integrated database retrieval system