KEGG   Edwardsiella ictaluri: NT01EI_3757Help
Entry
NT01EI_3757       CDS       T00912                                 

Definition
glycosyl hydrolases family 8 protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eic  Edwardsiella ictaluri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01EI_3757
Enzymes [BR:eic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NT01EI_3757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3643263..3644384)
Genome map
AA seq 373 aa AA seqDB search
MKESVYRTLMAAALLCVSVATVGAPCEWHEWEQFRQGYISPDGRVIDPSSPRQVTTSEGQ
SYALFFALVNNDRALFGKLLAWTQNNLSQGSLSQRLPAWKWGRHDDGRWRILDDNSASDA
DLWIAYTLLEAGRLWQDSDYQHLSIQLLARIAREEVVSLPGFGMMLLPGRQGFRSGALWT
INPSYLPPQILARIAPLHGPWNRLQYSALRMLEASSPHGIVPDWTNWQRNKGWLPTPGRA
YISGYDAIRAYLWAGMLADGAPAKSALVKHWQPMVALSERLGYIPEKVGVLGVEPQGEGN
VGFSAAMLPFLDASNSPLLAAQRQRVKDNLPGNNNYYSSVLTLFGLGWDQRRYRFNLQGE
LVPNWGSVCDVSD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtctgtttaccgtacactgatggccgctgcgttgctgtgtgtcagcgtcgcc
accgttggcgcaccctgtgaatggcatgagtgggagcagtttcgtcagggctatatcagc
cctgacgggcgggttatcgatcccagttctccccgccaggtaaccacctcggaggggcaa
agttatgcgctgttctttgccttggtcaataacgatcgcgcgttgttcggtaagttattg
gcatggacgcagaataatctgtcgcagggcagtctgagccagcgtttgccagcctggaag
tggggacgccatgatgacgggcgttggcgcatattggatgataactctgcctcggatgcc
gacctgtggatagcctatacgctgctggaggccgggcgcctgtggcaggattccgattac
caacatttgagtattcagctattggcgcggattgcccgggaggaggtggtctccttgccg
ggatttggcatgatgctgctgccgggtcgtcaggggttccgctctggcgctctgtggacg
ataaatccaagctacctgccaccgcagatcctggctcggattgcgccattgcatggaccg
tggaaccgtctgcagtacagcgcattgcgcatgttagaggcgtcgtcgccgcatggcatc
gtgccggactggacaaactggcagcggaataagggctggctgccgacgccggggcgggcc
tatatcagcggctatgatgccatccgggcctatctgtgggcgggaatgctggccgatggc
gctccggccaaaagcgcgctggtgaagcactggcagccgatggtggcgttgagtgagcgt
ctgggatatatccctgaaaaggtcggtgtactgggcgtagagccccagggtgaaggcaac
gttgggttctcggccgccatgttgccgtttctggatgccagcaacagtccgttattggcg
gcgcagcggcagcgggtaaaagacaacttgccggggaataataactactacagttcagtc
ctgacgctgtttggcctgggatgggatcagcggcgttaccgttttaatctacagggtgaa
ctggtgccaaactggggttccgtatgcgatgtttccgactga

DBGET integrated database retrieval system