KEGG   Edwardsiella ictaluri: NT01EI_3785Help
Entry
NT01EI_3785       CDS       T00912                                 

Definition
triose-phosphate isomerase, putative (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01EI_3785
   01230 Biosynthesis of amino acids
    NT01EI_3785
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_3785
   00051 Fructose and mannose metabolism
    NT01EI_3785
   00562 Inositol phosphate metabolism
    NT01EI_3785
Enzymes [BR:eic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT01EI_3785
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT01EI_3785
  Exosomal proteins of bladder cancer cells
   NT01EI_3785
  Exosomal proteins of melanoma cells
   NT01EI_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3666452..3667216)
Genome map
AA seq 254 aa AA seqDB search
MRQPLVMGNWKLNGSRHMVHELVAALRGELSDVANCDVAIAPPAVYLDMAAHELAGSRIA
LGAQDVSINASGAFTGEISAAMLKDIGAKYIIIGHSERRTYHKEGDAFIAEKFAALKEAG
LIPVLCIGETEAENEAGKTEEVCARQLDAVLKTMGAQVFKGAVIAYEPVWAIGTGKSATP
EQAQAVHKFIRDHVAQHDAEAAQEVIIQYGGSVNAANAADLFKQPDIDGALVGGASLKAD
AFATIVRAAAAYKA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccattagttatgggtaactggaaactgaacggtagccgccacatggttcat
gaactggttgccgccctgcgcggtgaactgagcgacgttgcaaactgcgatgtcgccatc
gctccgccggcagtttatctggatatggccgcccatgaactggccggtagccgtattgcc
ctcggtgcccaggacgtcagtatcaatgcctccggcgcattcaccggagaaatctccgca
gcgatgctgaaagacatcggtgcaaaatacatcatcattggtcactccgagcgccgtacc
taccacaaagaaggcgacgcgttcatcgcagaaaaatttgccgcactgaaagaagccggt
ctgatcccggtgctgtgcatcggtgagactgaagccgaaaacgaagcaggtaaaacggaa
gaagtctgcgcccgccagctggatgccgtactgaaaaccatgggtgctcaggtgtttaaa
ggcgccgttatcgcctatgaaccggtatgggccatcggcaccggaaaatctgccactccg
gaacaggctcaggctgtacacaaatttatccgcgatcacgttgcccagcacgacgctgaa
gccgcgcaggaagtcattatccagtacggcggttctgtcaacgcagccaatgcggccgat
ctgttcaagcagccggatatcgacggtgcactggtcggcggggcctcactgaaggccgat
gcgttcgccaccatcgtacgcgccgctgccgcatataaagcttaa

DBGET integrated database retrieval system