KEGG   Edwardsiella ictaluri: NT01EI_3785Help
Entry
NT01EI_3785       CDS       T00912                                 

Definition
(GenBank) triose-phosphate isomerase, putative
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00010  Glycolysis / Gluconeogenesis
eic00051  Fructose and mannose metabolism
eic00562  Inositol phosphate metabolism
eic01100  Metabolic pathways
eic01110  Biosynthesis of secondary metabolites
eic01120  Microbial metabolism in diverse environments
eic01130  Biosynthesis of antibiotics
eic01200  Carbon metabolism
eic01230  Biosynthesis of amino acids
Module
eic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eic_M00002  Glycolysis, core module involving three-carbon compounds
eic_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01EI_3785
   00051 Fructose and mannose metabolism
    NT01EI_3785
   00562 Inositol phosphate metabolism
    NT01EI_3785
Enzymes [BR:eic01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT01EI_3785
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT01EI_3785
  Exosomal proteins of bladder cancer cells
   NT01EI_3785
  Exosomal proteins of melanoma cells
   NT01EI_3785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACR70910
UniProt: C5BB68
Position
complement(3666452..3667216)
Genome map
AA seq 254 aa AA seqDB search
MRQPLVMGNWKLNGSRHMVHELVAALRGELSDVANCDVAIAPPAVYLDMAAHELAGSRIA
LGAQDVSINASGAFTGEISAAMLKDIGAKYIIIGHSERRTYHKEGDAFIAEKFAALKEAG
LIPVLCIGETEAENEAGKTEEVCARQLDAVLKTMGAQVFKGAVIAYEPVWAIGTGKSATP
EQAQAVHKFIRDHVAQHDAEAAQEVIIQYGGSVNAANAADLFKQPDIDGALVGGASLKAD
AFATIVRAAAAYKA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccattagttatgggtaactggaaactgaacggtagccgccacatggttcat
gaactggttgccgccctgcgcggtgaactgagcgacgttgcaaactgcgatgtcgccatc
gctccgccggcagtttatctggatatggccgcccatgaactggccggtagccgtattgcc
ctcggtgcccaggacgtcagtatcaatgcctccggcgcattcaccggagaaatctccgca
gcgatgctgaaagacatcggtgcaaaatacatcatcattggtcactccgagcgccgtacc
taccacaaagaaggcgacgcgttcatcgcagaaaaatttgccgcactgaaagaagccggt
ctgatcccggtgctgtgcatcggtgagactgaagccgaaaacgaagcaggtaaaacggaa
gaagtctgcgcccgccagctggatgccgtactgaaaaccatgggtgctcaggtgtttaaa
ggcgccgttatcgcctatgaaccggtatgggccatcggcaccggaaaatctgccactccg
gaacaggctcaggctgtacacaaatttatccgcgatcacgttgcccagcacgacgctgaa
gccgcgcaggaagtcattatccagtacggcggttctgtcaacgcagccaatgcggccgat
ctgttcaagcagccggatatcgacggtgcactggtcggcggggcctcactgaaggccgat
gcgttcgccaccatcgtacgcgccgctgccgcatataaagcttaa

DBGET integrated database retrieval system