KEGG   Edwardsiella ictaluri: NT01EI_3792Help
Entry
NT01EI_3792       CDS       T00912                                 

Definition
glycerol kinase, putative (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eic  Edwardsiella ictaluri
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NT01EI_3792
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NT01EI_3792
Exosome [BR:eic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NT01EI_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3672715..3674223)
Genome map
AA seq 502 aa AA seqDB search
MTTEQKYIVALDQGTTSSRAVILDHDANIISASQREFEQIYPKAGWVEHDPMEIWATQSS
TLTEAMAKADIESDQIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICEKLKRD
GLEEYIRHNTGLVVDPYFSGTKVKWILDHVEGARERAERGELLFGTVDTWLVWKMTQGRV
HVTDYTNASRTMLFNIHTLDWDERMLKVLDIPRAMLPQVRASSEIYGKTNIGGKGGTRIP
IAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGKKAVPSQHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLINDAADSEYFATKVKDSNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNNNHIIRATLESIAYQTRDVLDAMQADANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPAVLEVTALGAAYLAGLAVGYWSDLEELSSKASIEREFRPGIETVE
RNYRYSGWKKAVVRAQAWEDHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaacaaaaatacattgtcgctcttgaccagggcaccaccagctcccgcgcc
gtgatcctcgatcacgatgccaatatcatcagcgcctcccagcgcgagttcgaacagatt
tatcccaaggccggctgggtggagcacgacccgatggagatctgggcaacccagagttct
accctgacagaggcgatggccaaagccgatatcgaatccgatcagattgccgccatcggc
atcaccaaccagcgtgaaaccaccatcgtttgggaaaaagagaccggtaaaccggtctac
aacgccatcgtctggcagtgccgccgtaccgccgatatctgtgaaaagctcaagcgcgat
ggactggaagagtacatccgccacaacactggcctggtggtcgacccctacttctccggc
accaaggtgaagtggatcctggaccatgtcgaaggcgcccgtgaacgcgctgagcgcggc
gagctgctgttcggtaccgtcgatacctggctggtatggaagatgactcaaggccgggta
cacgtcaccgactataccaacgcttcccgcaccatgctgttcaacatccacacgctggac
tgggatgagcgcatgctgaaggtattggatatcccgcgtgcgatgctgccgcaggtgcgc
gcctcctccgaaatctatgggaaaaccaacatcggcggtaagggtggaacccgtatccct
atcgccggtatcgccggtgatcagcaggcggcgctgtttggccagctgtgtgtacagccg
gggatggcaaagaacacctacggcactggctgcttcctgctgatgaacaccggcaaaaag
gcggtaccgtcacagcacggcctgctgaccaccatcgcctgcggcccgcgcggcgaggtg
aactacgcactggaaggagctgtattcatcggcggcgcctccattcagtggctgcgcgac
gagctgaagctcatcaacgacgcggcggactccgagtattttgccactaaggtgaaagac
agcaacggcgtctacgtggtaccggcctttaccggtctgggtgccccttactgggatccc
tatgcccgcggcgccatctttggcctgacccgcggcgtcaacaataaccacatcatccgt
gccaccctggagtccatagcctaccagacccgcgacgtgctggatgccatgcaggccgat
gccaatacccgcctgcagtccctgcgcgtcgatggcggcgcggtcgccaacaacttcctg
atgcagttccagtcagacattctcggtactcgggttgaacgtccggcggtactggaagtc
acggcactcggcgcggcctacctggcgggtttggccgttggttactggagcgatctggag
gagcttagcagtaaggccagcattgagcgtgagttccgccccggcattgaaaccgtcgag
cgcaactatcgctacagcggctggaagaaagcggtggtacgcgcgcaggcctgggaagat
cacgactga

DBGET integrated database retrieval system