KEGG   Edwardsiella ictaluri: NT01EI_3892Help
Entry
NT01EI_3892       CDS       T00912                                 

Definition
ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eic  Edwardsiella ictaluri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eic00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NT01EI_3892
Enzymes [BR:eic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NT01EI_3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3768422..3769351)
Genome map
AA seq 309 aa AA seqDB search
MQTGKLVVLGSINADHILKVEHFPRPGETLTGQGYQVAFGGKGANQAVAAGRSGADIAFI
ACVGADDIGERIRTQLAGDGIDIHAVERVDGESTGVALIFVNQDGENVIGINAGANHALT
PQYLSHHRTLVVQADALLMQLESPLETVEAAAVLAREHQTKVILNPAPARTLPDSLLRLV
DVITPNETEAEHLTGIRVHSDESARQAAAVLHGKGIETVMITLGRRGVWVSQEGYGEVIP
GFRVNAVDTIAAGDTFNGALLTALLEGNTLPAAVRFAHAAAAIAVTREGAQSSVPWRREI
DAFLQTHQE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaggcaaactggtcgtattaggcagtatcaatgccgatcacattctcaaggtc
gaacattttccccgccccggcgaaaccttaaccggacagggatatcaggtggcattcggc
ggtaaaggggccaatcaggccgttgccgccgggcgcagcggtgcggatattgcctttatt
gcctgtgttggcgccgatgatatcggcgaacggatccgaacccagttggccggtgatggg
atcgatatacacgccgtggagcgcgtcgatggcgaaagcaccggcgtggcactgattttt
gtcaatcaggatggggagaatgtcattggcatcaacgccggtgctaatcatgcgctgacg
ccgcagtatctatctcaccaccggacgctggtggtgcaggcagatgcgctgctgatgcag
ctggagtcaccgttggagaccgttgaagccgccgcggtgctggcccgagagcatcagacc
aaggtaattttgaatcccgcaccggcgcggacgctgccggattctctgctgcggctggtg
gatgtcatcactcccaatgagaccgaggctgagcatctgaccggtattcgggtccacagc
gatgagagtgctcgccaagccgccgctgtattgcacggtaaaggcatcgaaaccgtgatg
ataacgcttggtcgccgcggcgtttgggtcagccaggaggggtatggtgaagtgatcccg
ggatttagggttaacgctgtcgataccattgctgccggggatacctttaacggtgcgttg
ctaaccgctctgctggaggggaataccctgcctgccgccgtgcgctttgcccatgctgcc
gcggcgatcgccgtgacgcgtgagggcgcgcagtcctctgtcccttggcgccgtgagatc
gatgccttcctacagacgcatcaggagtaa

DBGET integrated database retrieval system