KEGG   Escherichia coli IHE3034: ECOK1_1393Help
Entry
ECOK1_1393        CDS       T01997                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eih  Escherichia coli IHE3034
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eih00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECOK1_1393 (tdk)
Enzymes [BR:eih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ECOK1_1393 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412679..1413296
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRAEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEVGSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcacctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgtgcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtttacgtaccgatttt
cgaggtgaattatttattggcagtcaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggttattggtggtaatgaacgctacgtttct
gtatgccgtaaacactataaagaagcgttagaagtcggctcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system