KEGG   Escherichia coli IHE3034: ECOK1_1437Help
Entry
ECOK1_1437        CDS       T01997                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eih  Escherichia coli IHE3034
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1451496..1452029
Genome map
AA seq 177 aa AA seqDB search
MNAKIKYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTTAYRDGSGNWTICRGATMVDG
KPVFPGMKLSKEKCDQVNAIERDKALAWVEKNIKVPLSEPQKAGIASFCPYNIGPGKCFP
STFYKRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWGIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcaaatacggcctgtcagctgcagttctggcgctgattggagcaggc
gcatcagctcctcagatacttgaccagtttctggatgaaaaagagggtaaccacactacg
gcataccgcgatggttccggcaactggaccatctgtcggggggccacgatggtggatgga
aaacccgtttttcccggtatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagaaaaacatcaaagtgccattgagcgaaccc
cagaaagcggggatcgcgtcattctgtccgtacaacattggtcccggtaagtgtttcccg
tcgacgttttataaacgaattaatgcaggtgatcgcaggggagcgtgtgaggcgattcgc
tggtggattaaggacggtggcagagactgccgtattcgttcaaacaactgctacggtcag
gtatcccgtcgtgaccaggagagcgcgctggcgtgctggggtatcgacagataa

DBGET integrated database retrieval system